KEGG   Enterobacter cloacae ECNIH3: ECNIH3_01380Help
Entry
ECNIH3_01380      CDS       T03350                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ecla  Enterobacter cloacae ECNIH3
Brite
Translation factors [BR:ecla03012]
 Eukaryotic Type
  Elongation factors
   ECNIH3_01380 (tuf)
 Prokaryotic Type
   ECNIH3_01380 (tuf)
Mitochondrial biogenesis [BR:ecla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECNIH3_01380 (tuf)
Exosome [BR:ecla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECNIH3_01380 (tuf)
  Exosomal proteins of breast cancer cells
   ECNIH3_01380 (tuf)
  Exosomal proteins of colorectal cancer cells
   ECNIH3_01380 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
280722..281906
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgtactggctaaaacctac
ggcggtgctgctcgtgctttcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgagtatgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgtcaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggccctatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttcctttcatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgatactccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggttctggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacatcaagatggtt
gtgactctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system