KEGG   Enterobacter cloacae ECNIH5: ECNIH5_20595Help
Entry
ECNIH5_20595      CDS       T03706                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECNIH5_20595
   00650 Butanoate metabolism
    ECNIH5_20595
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECNIH5_20595
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECNIH5_20595
Enzymes [BR:ecli01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECNIH5_20595
Amino acid related enzymes [BR:ecli01007]
 Aminotransferase (transaminase)
  Class III
   ECNIH5_20595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4337426..4338691)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKADNATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIEGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQFPNSLHGVSTA
EALKSLERIFKADIAPDQVAAIIIEPVQGEGGFNVAPADFMQALRALCDTHGILLIADEV
QTGFARTGKLFSMENHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRASHLGHHLVEVLNKAKDGCPWIADIRGQGSMVAVEFTD
PQTGQPSPEFTRQVQERALNEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggtatcggcgtc
atgtgtaacttctatgccgataaagccgacaacgccacggtgtgggatgtagaaggtaac
gagtatattgattttgccgccgggatcgccgtgctgaataccgggcatcgccatcctaaa
gttatcgccgccatcgaaaaacagcttcatgcctttacccataccgcttaccagatcgtc
ccctatgaaggttatgtggcgcttgccgagcgcatcaaccagcgcgtacccatagagggg
ccagccaaaaccgcctttttctcaaccggtgcagaagcggtcgaaaacgcggtgaaaatt
gctcgcgcgtacaccagacgtcccggccttatcaccttcggcggcgcgttccacggccgt
acctttatgaccatggcgctgaccggcaaagtggcgccctataagctcggcttcggcccg
ttccccggctcggtgtaccacgcgcaattccccaacagcctgcacggcgtcagtaccgcc
gaagcgttaaaaagcctggagcgcatcttcaaagccgatatcgcgcccgatcaggtggcg
gcaatcattattgaaccggttcagggcgagggcggattcaacgtcgcgcccgctgatttt
atgcaggcgctgcgtgccctgtgcgatacccacgggattttactgattgccgacgaagtg
caaaccggcttcgcccgtaccggcaagctattctccatggaaaaccactgcgtgaagccc
gatctgatcaccatggcgaaaagcctggcgggcggaatgccgctctctgccgtctctggc
cgggcagaggtgatggacgcgcccgctccgggcggactgggcggcacctacgcgggtaac
ccgctggcgattgcggcggcccatgcggtgctggacgtgattgacgaggaagatctctgc
acgcgcgcgtctcatctcggccatcatcttgtcgaggtgctgaataaagcgaaggatggc
tgtccctggatcgccgatatccgtgggcagggctcgatggtggcggtggaatttaccgat
ccgcaaaccggacagccgtcgccggaatttacccgtcaggttcaggagcgcgcgttgaac
gaagggctgctgcttttgagttgcggcgtctacggcaacgttatccgcttcctctacccg
ctcaccatccccgaagcgcagttccgtaaagcgctggatattatttccgcctcgctgaca
cgataa

DBGET integrated database retrieval system