KEGG   Enterobacter cloacae ECNIH4: ECNIH4_13010Help
Entry
ECNIH4_13010      CDS       T03486                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ecln00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECNIH4_13010
Enzymes [BR:ecln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ECNIH4_13010
Transporters [BR:ecln02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECNIH4_13010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2736993..2737598
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFLAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTLRALLEKKLQYVNASLKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHITS
YMTRMAERPAVAAALKAEGLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccatatcaccctgcgcgag
agcggcaaagatttcacgctcgatggcgttgatctgatgaaaaagcgtctggagaatggt
gatgatttccttgccattaacccgaagggacaagttccagcgctgttgctggatgacgga
actctgctgacagaaggcgttgccatcatgcaattcctggcggacaacgtaccggatcgc
cagcttcttgcccccaccggcagcattgcacgttataagaccctggagtggttaaactat
atcgctaccgagttacataaaggctttactcccctgttccgcccggatacgccggaagag
tacaaaccgaccctgcgcgcgcttcttgagaaaaagctgcagtatgtaaacgcgtcgctg
aaagacgatcagtggatttgtggttcccgtttcacgattgccgatgcctatctgtttacc
gtgctgcgctgggcgcgggcggttaagctcaatatggaaggcttagaccatattacatcg
tatatgacccgtatggcggagcgccctgctgtggctgcggcgctgaaagcggaaggtctt
agctaa

DBGET integrated database retrieval system