KEGG   Enterobacter cloacae complex sp. 35734: LI67_024125Help
Entry
LI67_024125       CDS       T04878                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Brite
Enzymes [BR:ecls01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LI67_024125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(4902201..4902821)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacaccaccagacctacgtgaacaacgcgaac
gccgcgctggaaagcctgcctgagttcgctaacctgcctgttgaagagctgatcaccaag
ctggaccagctgccagcggacaagaaaaccgtgctgcgcaacaacgcgggcggtcacgct
aaccatagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgatctgaaa
gcggctatcgagcgcgacttcggttccgttgacaacttcaaagcggaattcgagaaagcc
gctgcaacccgcttcggctctggctgggcgtggctggtactgaaaggtgacaaactggcc
gtggtttctaccgcgaaccaggactccccgctgatgggtgaagcgatctctggcgcatcc
ggcttcccaatcctgggtctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgcccggactacattaaagcgttctgggacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system