KEGG   Escherichia coli APEC O78: APECO78_11995Help
Entry
APECO78_11995     CDS       T02445                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ecoa  Escherichia coli APEC O78
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    APECO78_11995
Enzymes [BR:ecoa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APECO78_11995
Transporters [BR:ecoa02000]
 Other Transporters
  Pores ion channels [TC:1]
   APECO78_11995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2472350..2472955
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVLRWAYAVKLNLEGFEHIAA
FMQRMAERPEVQDALSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctacaaaccgggtgcctgctctctcgcttcccatatcaccctgcgtgag
agcggaaaggattttaccctcgtcagtgtggatttaatgaaaaaacgtctcgaaaacggt
gacgattactttgccgttaaccctaaggggcaggtgcctgcattgctgctggatgacggt
actttgctgacggaaggcgtagcgattatgcagtatcttgccgacagcgtccccgaccgc
cagttgctggcaccggtaaacagtatttcccgctataaaaccatcgaatggctgaattac
atcgccaccgagctgcataaaggtttcacacctctgtttcgccctgatacaccggaagag
tacaaaccgacagttcgcgcgcagctggagaagaagctgcaatatgtgaacgaggcactg
aaggatgagcactggatctgcgggcaaagatttacaattgctgatgcctatctgtttacg
gttctgcgctgggcatacgcggtgaaactgaatctggaagggtttgagcacattgcagca
tttatgcaacgtatggctgaacgtccggaagtacaagacgcgctgtcagcggaaggctta
aagtaa

DBGET integrated database retrieval system