KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_3368Help
Entry
EC958_3368        CDS       T04373                                 

Definition
(GenBank) putative saframycin Mx1 synthetase B
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Brite
Enzymes [BR:ecos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     EC958_3368
Lipid biosynthesis proteins [BR:ecos01004]
 Acyl-CoA synthetase
  Unknown
   EC958_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3408334..3410067
Genome map
AA seq 577 aa AA seqDB search
MVYMSNKIFTHSLPMRYADFPTLVDALDYAALSSAGMNFYDRRCQLEDQLEYQTLKARAE
AGAKRLLSLNLKKGDRVALIAETSSGFVEAFFACQYAGLVAVPLAIPMGVGQRDSWSAKL
QGLLASCQPAAIITGDEWLPLVNAATHNNNPELHVLSHAWFKALPEADVALQRPVPNDIA
YLQYTSGSTRFPRGVIITHREVMANLRAISHDGIKLRPGDRCVSWLPFYHDMGLVGFLLT
PVATQLSVDYLRTQDFAMRPLQWLKLISKNRGTVSVAPPFGYELCQRRVNEKDLAELDLS
CWRVAGIGAEPISAEQLHQFAECFRQVNFDDKTFMPCYGLAENALAVSFSDEASGVVVNE
VDRDILEYQGKAVAPDAETRAVSTFVNCGKALPEHGIEIRNEAGIPVAERVVGHICISGP
SLMSGYFGDQISQDEIAATGWLDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYI
AEQEPEIHSGDAIAFVTAQEKIILQIQCRISDEERRGQLIHALAARIQSEFGVTADIDLL
PPHSIPRTSSGKPARAEAKKRYQKAYAASLHVQESLA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtatatgtctaataaaatctttacgcattccctacctatgcgctatgccgatttt
ccaacgctggttgatgctttggactatgccgctctgagtagcgctggaatgaatttttat
gacagacgttgccaacttgaagatcaactggaatatcagacgttaaaagcgcgtgccgaa
gctggtgcgaagcggttgttatcgctaaacctgaaaaaaggcgatcgcgtggcactgatt
gccgaaaccagtagcgggttcgtagaggctttttttgcctgccagtatgccggcttagtc
gccgtcccgttggcgattcccatgggcgtcggtcagcgggattcctggagcgccaagctg
cagggtttactggcaagttgccagcccgcagccattatcactggtgatgagtggttgcca
ctggtcaatgccgcgacgcataacaacaaccccgaattacatgttttaagccacgcctgg
tttaaggcattaccggaagccgatgttgcgctccagcgtccagttccgaacgatatcgcc
tacctccagtacacctccggcagcacccgttttccccgtggcgtcattatcacccatcgc
gaagtgatggctaatctacgtgctataagccacgatggcataaaattacgccctggcgac
cgctgcgtctcctggctgcctttctaccatgatatgggactggtcggctttctcctgacc
cccgtcgccacgcagctttcagtagattatttgcgcactcaggattttgccatgcgtcct
ctgcaatggcttaaattgatcagtaaaaatcgcggcaccgtttccgttgcgccgccgttt
ggctatgaattgtgccagcgccgcgtgaatgaaaaagatctcgctgaactggatctttcc
tgctggcgcgtcgctggtattggtgcagaacccatctccgcagaacaactccatcaattc
gctgaatgtttccgtcaggtcaactttgacgataaaactttcatgccgtgctacggactg
gcagaaaatgcgctggctgtcagcttctctgatgaagcttccggggttgtggttaacgaa
gtggatcgcgacatcctcgaatatcagggcaaagccgtcgcgccggatgctgaaacacgc
gccgtatcgactttcgtcaactgcggtaaagcgttgccggaacatggcattgaaatccgc
aatgaagcaggtatacctgtcgcggaacgtgtggtaggccatatttgcatctccggccct
agcctgatgagcggttactttggcgaccagatttcacaagacgagattgccgcgacgggc
tggttagacaccggcgacctcggttatctgctggacggttatctgtatgtcaccggacgc
attaaagatctgattattattcgtggccgtaatatctggccgcaggatattgaatatatt
gcggaacaggaaccggaaattcattctggcgatgcgattgcttttgttaccgcccaggaa
aaaatcattttgcagatccagtgtcggatcagcgatgaagaacgtcgcgggcagcttatc
cacgcgctggcagcacggatccaaagcgaatttggcgttaccgcggatatcgatctgttg
ccgccccacagtattccccgaacatcctccggcaagcctgcccgtgcggaagcgaaaaaa
cgttatcagaaggcttatgctgccagtcttcatgtgcaggagtccctggcatga

DBGET integrated database retrieval system