KEGG   Escherichia coli O9 HS (commensal): EcHS_A4190Help
Entry
EcHS_A4190        CDS       T00591                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ecx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcHS_A4190 (ppc)
  Energy metabolism
   00680 Methane metabolism
    EcHS_A4190 (ppc)
Enzymes [BR:ecx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EcHS_A4190 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(4180359..4183010)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtcgaaatcttcacgcgctggcaatgatgctaaccgccaggagttgctcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcacccaacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgtttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttgatcgcccagtcatggcataccgatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtggaaaacagcctgtggcaaggcgtaccaaattac
ctgcgcgaactgaacgaacaactggaagagaacctcggctacaaactgcccgtcgaattt
gttccggtccgttttacttcgtggatgggcggcgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctactcagccgctggaaagccaccgatttgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggcctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtccgtattgatatccgtcaggagagcacg
cgtcataccgaagcgctgggcgagctgacccgctacctcggtatcggcgactacgaaagc
tggtcagaggccgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctt
ctgccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcaccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtactggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaaccctcgatgatctgaacaacgccaacgatgtcatgacccag
ctgctcaatattgactggtatcgtggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggagtgatggcagcttcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggcgcacctgctcatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgactgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctgtacaccggggcgattctggaa
gccaacctgctgccaccacctgagccgaaagagagctggcgtcgcattatggatgaactg
tcagtcatctcctgcgatctctaccgtggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaagaattgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactacgcgccattccgtggatcttcgcc
tggacgcaaaaccgtctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gtggtcgaagacggcaaacagagcgagctggaggctatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgaccaacgcctggtagacaaagcactgtggccgttaggtaaagagttacgcaac
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaggccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgaacaagcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system