KEGG   Enterobacter cloacae EcWSU1: EcWSU1_01920Help
Entry
EcWSU1_01920      CDS       T01652                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EcWSU1_01920 (gst)
Enzymes [BR:eec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EcWSU1_01920 (gst)
Transporters [BR:eec02000]
 Other Transporters
  Pores ion channels [TC:1]
   EcWSU1_01920 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1980779..1981384)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFFAINPKGQVPALLLDDG
TLLTEGVAIMQFLADSVPDRQLLAPVSTVSRYKTLEWMNYIATELHKGFTPLFRPETPEE
YKPTVRAQLEKKLQYVNASLKDDQWIGGARFTIADAYLFTVLRWARAIKLNMDGLDHIAS
YMDRVAARPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccacattaccctgcgcgag
agcggcaaagatttcacgctggatggcgttgacctcatgaaaaaacgcctggaaaacggc
gatgatttttttgctattaacccgaagggacaagttccggctctgctgctggatgacggt
accctgctgaccgaaggcgtggcgattatgcagttcctcgccgatagcgtgcccgacagg
caattgctggcaccggtaagcacggtttctcgctacaaaacgctggagtggatgaactac
attgcgaccgagctgcacaaaggctttaccccgctgttccgtccggagacgccggaagag
tacaaaccgaccgtacgtgctcagctggagaaaaaactgcagtacgttaacgcatcgctg
aaagacgatcagtggattggaggcgcgcgttttacaattgctgatgcctatctgttcacc
gtgctgcgctgggcgcgggccattaagctcaacatggacgggctggaccacattgcatcg
tacatggatcgcgtagccgcgcgtcctgcggtggctgcagcgcttaaagcagaagggttg
aactga

DBGET integrated database retrieval system