KEGG   Enterococcus faecium Aus0004: EFAU004_02304Help
Entry
EFAU004_02304     CDS       T01772                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
efc  Enterococcus faecium Aus0004
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EFAU004_02304 (tdk)
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EFAU004_02304 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2340893..2341477)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDGLGVVSSRIGLKRNAM
PIFEETDVFDVIQKMESKPYCVLIDEAQFLKKKHVIAFTRIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCHKKAIMNLHYIDGNPVYEGDQVQIGGNEAYYPVC
RKHYFHPSMITEGE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattttttaagtatggcgcaatgaatagcggcaagacgatcgagatccta
aaagtcgcacataattatgaagaacaaaataagccagttgtcttaatgacaagcggtatt
gatacaagagatggtttaggcgttgtttcaagccgaatcggactgaaacgtaatgcgatg
ccgatatttgaagaaacagacgtatttgacgtaattcagaaaatggaaagcaaaccctat
tgtgtgctgatcgatgaagcgcaattcttaaaaaagaaacatgtcattgcttttacgaga
attgtggacgaattggatattccggttatggcatttggtttgaaaaatgattttcgaaac
gagttatttgaaggatcaaaatatttattgctttatgcagacaaaatcgaagaaatgaaa
acaatctgttggttctgccacaaaaaagcaatcatgaatttacattatattgatggaaac
cctgtttatgaaggcgatcaagtgcaaattggcggaaatgaagcttattaccccgtttgt
cgaaaacattactttcacccatcaatgattacagaaggagaataa

DBGET integrated database retrieval system