KEGG   Enterococcus faecalis D32: EFD32_0658Help
Entry
EFD32_0658        CDS       T02172                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
efd  Enterococcus faecalis D32
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EFD32_0658
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFD32_0658
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EFD32_0658
Enzymes [BR:efd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EFD32_0658
Peptidoglycan biosynthesis and degradation proteins [BR:efd01011]
 Precursor biosynthesis
  Amino acid ligase
   EFD32_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
681017..682087
Genome map
AA seq 356 aa AA seqDB search
MKIILLYGGRSEEHDVSVLSAYSVLNAIYYKYYQVQLVFISKDGQWVKGPLLSERPQNKE
VLHLTWAQTPEETGEFSGKRISPSEIYEEEAIVFPVLHGPNGEDGTIQGFMETINMPYVG
AGVLASANAMDKIMTKYLLQTVGIPQVPFVPVLRSDWKGNPKEVFEKCEGSLIYPVFVKP
ANMGSSVGISKAENREELQEALEEAFRYDARAIVEQGIEAREIEVAILGNEDVRTTLPGE
VVKDVAFYDYDAKYINNTIEMQIPAHVPEEVAHQAQEYAKKAYIMLDGSGLSRCDFFLTS
KNELFLNELNTMPGFTDFSMYPLLWENMGLKYSDLIEELIQLALNRFKQRQEFYNN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattattttgttgtatggcggcagaagtgaagagcacgatgtgtctgttttgtct
gcatattccgttttaaatgcaatctattataaatattatcaagtacagttagtctttatt
agtaaagacggtcaatgggtaaaaggccctctcttatctgaacgaccacaaaataaagaa
gttttacatttaacttgggcacaaacacctgaagaaacaggcgaattttcaggaaaacga
atcagtccttcggaaatttatgaagaagaagcgattgttttccctgttttacatggacca
aatggtgaagatggaacaattcaaggattcatggaaaccattaatatgccttatgtgggc
gcaggtgtcttagctagtgctaacgcaatggacaaaatcatgacgaaatatcttttacaa
actgttggcattccacaagtaccattcgtgccagttttaagaagtgactggaaaggaaat
ccaaaagaagtctttgaaaaatgtgaaggttctttaatctatccggtctttgttaaacct
gccaatatgggttctagtgtcggaattagcaaagcggaaaatcgtgaagaattgcaagaa
gcattggaagaagctttccgttatgatgcccgagcaattgttgaacaagggattgaagca
cgtgaaattgaagtagccattttaggaaatgaagatgtccgtacgactttacctggtgaa
gtggtgaaagatgtcgctttctatgattatgatgcaaaatacatcaataacacgattgaa
atgcaaatcccagcgcatgttccagaagaagtagctcatcaagcgcaagaatacgctaaa
aaagcgtatattatgttagatggaagtggcttaagtcgctgtgatttcttcttaacaagc
aaaaacgaattattcctgaatgaattgaacaccatgcctggttttactgactttagtatg
tatcctttactgtgggaaaatatgggcttgaaatacagtgatttaattgaggaactgatt
cagttagctttgaatcgttttaaacaacgccaagaattttataataactaa

DBGET integrated database retrieval system