KEGG   Enterococcus faecalis ATCC 29212: DR75_1264Help
Entry
DR75_1264         CDS       T03320                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
efq  Enterococcus faecalis ATCC 29212
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    DR75_1264
Enzymes [BR:efq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DR75_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1320266..1320850)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGVGKVSSRIGLRRDAI
PIFEETNVFDLINDLSYKPFCVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKLEELKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYYPVC
RKHYFHPKTVNEEQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattatttttcaagtatggcgcaatgaacagtggtaaaaccattgaaatctta
aaagtagcacacaattacgaagaacaagacaaaccagttgttttgatgaccagtggacta
gatacacgtgatggtgtcgggaaagtatccagtcgcatcggattacgcagagatgctatt
ccaatttttgaagaaaccaatgtctttgacttgattaatgatttgtcttacaaacctttt
tgcgtattagtcgatgaatgtcaatttttaaacaagcatcatgtcattgaatttgcacga
attgttgacgaattagatattccagtaatggcatttgggctaaagaatgattttagaaat
gaattatttgaaggctcaaagtatttacttttatatgcagacaaattagaagaattaaaa
acgatttgctggttctgtcataaaaaagcaactatgaacttgcactatattgatggcaaa
cccgtttatgaaggggatcaagtccaaattggtgggaatgaagcctactatcctgtttgt
cgcaaacattattttcatccaaaaacagtgaatgaagaacagtaa

DBGET integrated database retrieval system