KEGG   Enterococcus faecium DO: HMPREF0351_10261Help
Entry
HMPREF0351_10261  CDS       T02120                                 

Gene name
gadB
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
efu  Enterococcus faecium DO
Pathway
efu00250  Alanine, aspartate and glutamate metabolism
efu00410  beta-Alanine metabolism
efu00430  Taurine and hypotaurine metabolism
efu00650  Butanoate metabolism
efu01100  Metabolic pathways
efu01110  Biosynthesis of secondary metabolites
efu01120  Microbial metabolism in diverse environments
efu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0351_10261 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0351_10261 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF0351_10261 (gadB)
   00430 Taurine and hypotaurine metabolism
    HMPREF0351_10261 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0351_10261 (gadB)
Enzymes [BR:efu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HMPREF0351_10261 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 12998920
NCBI-ProteinID: YP_006374867
UniProt: Q3Y080
LinkDB All DBs
Position
253345..254745
Genome map
AA seq 466 aa AA seqDB search
MLYGKDNQEEKNYLEPIFGSASEDVDLPKYKLNKESIEPRIAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMTQTLEKNAIDKSEYPRTTEIENRCVNMIADLWHAPNNEKFMGTS
TIGSSEACMLGGMAMKFAWRKRAEKLGLDIQAKKPNLVISSGYQVCWEKFCVYWDVELRE
VPMDEKHMSINLDTVMDYVDEYTIGIVGIMGITYTGRYDDIKGLNDLVEAHNKQTDYKVY
IHVDAASGGFYAPFTEPDLVWDFQLKNVISINSSGHKYGLVYPGVGWVLWRDQQYLPEEL
VFKVSYLGGEMPTMAINFSHSAAQLIGQYYNFVRYGFDGYRDIHQRTHDVAVYLAKEIEK
TGIFEIINDGSELPVVCYKLKEDPNREWTLYDLSDRLLMKGWQVPAYPLPKDLDQLIIQR
LVVRADFGMNMAGDYVQDMNQAIEELNKAHIVYHKKQDVKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagataatcaagaagaaaaaaactatttggaaccaatttttggctct
gcaagtgaggatgttgacttgcctaaatataagttaaacaaagaatccattgaaccacga
attgcttatcaattagtacaagacgagatgttggatgaaggaaatgcgcgattaaactta
gctactttttgtcaaacgtatatggaacctgaagcagtgaaattgatgacccaaacgtta
gaaaaaaatgcaattgataaatcagaatacccacgaacaacggaaattgaaaaccgctgt
gtaaatatgattgctgatttatggcatgctccaaataatgaaaaattcatgggaacttca
acgatcggctcttcagaagcctgcatgctgggtggtatggccatgaaatttgcttggcgt
aaacgtgctgaaaaattaggtcttgatattcaagcaaaaaaacctaacctggtgatctct
tctggttaccaagtttgttgggaaaaattctgtgtatattgggatgtggaactgagagaa
gtcccaatggatgaaaaacatatgtcaattaatctagatactgtcatggattatgtggat
gagtacacaattggtattgtaggtattatgggtattacttacactggtcgttatgatgat
atcaagggtctgaatgatttagttgaagctcacaataaacaaactgactataaagtatac
attcatgttgacgctgcatcgggtggcttttatgcaccatttactgaacctgatctagtt
tgggattttcaattgaaaaatgttatctcaattaattcttcaggtcacaaatatggtttg
gtatatccaggtgtgggttgggtcttatggcgtgaccaacaatacttaccagaagaatta
gtatttaaagttagttacttaggtggagaaatgccaactatggctatcaacttctctcat
agtgcagcacaactaattgggcaatactacaactttgtacgctatggctttgatggttat
cgtgatattcaccaaagaactcatgatgttgctgtttatttagccaaagagatcgaaaaa
actggtatttttgaaatcattaatgatggatcagaattgccagttgtgtgctataagctg
aaagaagatcccaatcgcgaatggacactatatgatttatctgatcgtctgttaatgaag
ggatggcaagtcccagcctacccattacctaaagacttggatcaattaattattcaacgc
ttagttgttcgagcagactttggaatgaacatggctggtgattatgtacaagatatgaac
caagcaattgaagagttgaataaagctcatattgtttatcataaaaaacaggatgtgaaa
acgtacggctttactcactaa

DBGET integrated database retrieval system