KEGG   Enterococcus faecium DO: HMPREF0351_10261Help
Entry
HMPREF0351_10261  CDS       T02120                                 

Gene name
gadB
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
efu  Enterococcus faecium DO
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:efu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0351_10261 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0351_10261 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF0351_10261 (gadB)
   00430 Taurine and hypotaurine metabolism
    HMPREF0351_10261 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0351_10261 (gadB)
Enzymes [BR:efu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HMPREF0351_10261 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
253345..254745
Genome map
AA seq 466 aa AA seqDB search
MLYGKDNQEEKNYLEPIFGSASEDVDLPKYKLNKESIEPRIAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMTQTLEKNAIDKSEYPRTTEIENRCVNMIADLWHAPNNEKFMGTS
TIGSSEACMLGGMAMKFAWRKRAEKLGLDIQAKKPNLVISSGYQVCWEKFCVYWDVELRE
VPMDEKHMSINLDTVMDYVDEYTIGIVGIMGITYTGRYDDIKGLNDLVEAHNKQTDYKVY
IHVDAASGGFYAPFTEPDLVWDFQLKNVISINSSGHKYGLVYPGVGWVLWRDQQYLPEEL
VFKVSYLGGEMPTMAINFSHSAAQLIGQYYNFVRYGFDGYRDIHQRTHDVAVYLAKEIEK
TGIFEIINDGSELPVVCYKLKEDPNREWTLYDLSDRLLMKGWQVPAYPLPKDLDQLIIQR
LVVRADFGMNMAGDYVQDMNQAIEELNKAHIVYHKKQDVKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagataatcaagaagaaaaaaactatttggaaccaatttttggctct
gcaagtgaggatgttgacttgcctaaatataagttaaacaaagaatccattgaaccacga
attgcttatcaattagtacaagacgagatgttggatgaaggaaatgcgcgattaaactta
gctactttttgtcaaacgtatatggaacctgaagcagtgaaattgatgacccaaacgtta
gaaaaaaatgcaattgataaatcagaatacccacgaacaacggaaattgaaaaccgctgt
gtaaatatgattgctgatttatggcatgctccaaataatgaaaaattcatgggaacttca
acgatcggctcttcagaagcctgcatgctgggtggtatggccatgaaatttgcttggcgt
aaacgtgctgaaaaattaggtcttgatattcaagcaaaaaaacctaacctggtgatctct
tctggttaccaagtttgttgggaaaaattctgtgtatattgggatgtggaactgagagaa
gtcccaatggatgaaaaacatatgtcaattaatctagatactgtcatggattatgtggat
gagtacacaattggtattgtaggtattatgggtattacttacactggtcgttatgatgat
atcaagggtctgaatgatttagttgaagctcacaataaacaaactgactataaagtatac
attcatgttgacgctgcatcgggtggcttttatgcaccatttactgaacctgatctagtt
tgggattttcaattgaaaaatgttatctcaattaattcttcaggtcacaaatatggtttg
gtatatccaggtgtgggttgggtcttatggcgtgaccaacaatacttaccagaagaatta
gtatttaaagttagttacttaggtggagaaatgccaactatggctatcaacttctctcat
agtgcagcacaactaattgggcaatactacaactttgtacgctatggctttgatggttat
cgtgatattcaccaaagaactcatgatgttgctgtttatttagccaaagagatcgaaaaa
actggtatttttgaaatcattaatgatggatcagaattgccagttgtgtgctataagctg
aaagaagatcccaatcgcgaatggacactatatgatttatctgatcgtctgttaatgaag
ggatggcaagtcccagcctacccattacctaaagacttggatcaattaattattcaacgc
ttagttgttcgagcagactttggaatgaacatggctggtgattatgtacaagatatgaac
caagcaattgaagagttgaataaagctcatattgtttatcataaaaaacaggatgtgaaa
acgtacggctttactcactaa

DBGET integrated database retrieval system