KEGG   Eptesicus fuscus (big brown bat): 103285154
Entry
103285154         CDS       T09083                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
efus  Eptesicus fuscus (big brown bat)
Pathway
efus01521  EGFR tyrosine kinase inhibitor resistance
efus01522  Endocrine resistance
efus04010  MAPK signaling pathway
efus04012  ErbB signaling pathway
efus04014  Ras signaling pathway
efus04015  Rap1 signaling pathway
efus04062  Chemokine signaling pathway
efus04068  FoxO signaling pathway
efus04071  Sphingolipid signaling pathway
efus04072  Phospholipase D signaling pathway
efus04137  Mitophagy - animal
efus04140  Autophagy - animal
efus04150  mTOR signaling pathway
efus04151  PI3K-Akt signaling pathway
efus04210  Apoptosis
efus04211  Longevity regulating pathway
efus04213  Longevity regulating pathway - multiple species
efus04218  Cellular senescence
efus04360  Axon guidance
efus04370  VEGF signaling pathway
efus04371  Apelin signaling pathway
efus04540  Gap junction
efus04550  Signaling pathways regulating pluripotency of stem cells
efus04625  C-type lectin receptor signaling pathway
efus04650  Natural killer cell mediated cytotoxicity
efus04660  T cell receptor signaling pathway
efus04662  B cell receptor signaling pathway
efus04664  Fc epsilon RI signaling pathway
efus04714  Thermogenesis
efus04720  Long-term potentiation
efus04722  Neurotrophin signaling pathway
efus04725  Cholinergic synapse
efus04726  Serotonergic synapse
efus04730  Long-term depression
efus04810  Regulation of actin cytoskeleton
efus04910  Insulin signaling pathway
efus04912  GnRH signaling pathway
efus04914  Progesterone-mediated oocyte maturation
efus04915  Estrogen signaling pathway
efus04916  Melanogenesis
efus04917  Prolactin signaling pathway
efus04919  Thyroid hormone signaling pathway
efus04921  Oxytocin signaling pathway
efus04926  Relaxin signaling pathway
efus04929  GnRH secretion
efus04933  AGE-RAGE signaling pathway in diabetic complications
efus04935  Growth hormone synthesis, secretion and action
efus04960  Aldosterone-regulated sodium reabsorption
efus05010  Alzheimer disease
efus05022  Pathways of neurodegeneration - multiple diseases
efus05034  Alcoholism
efus05160  Hepatitis C
efus05161  Hepatitis B
efus05163  Human cytomegalovirus infection
efus05165  Human papillomavirus infection
efus05166  Human T-cell leukemia virus 1 infection
efus05167  Kaposi sarcoma-associated herpesvirus infection
efus05170  Human immunodeficiency virus 1 infection
efus05200  Pathways in cancer
efus05203  Viral carcinogenesis
efus05205  Proteoglycans in cancer
efus05206  MicroRNAs in cancer
efus05207  Chemical carcinogenesis - receptor activation
efus05208  Chemical carcinogenesis - reactive oxygen species
efus05210  Colorectal cancer
efus05211  Renal cell carcinoma
efus05212  Pancreatic cancer
efus05213  Endometrial cancer
efus05214  Glioma
efus05215  Prostate cancer
efus05216  Thyroid cancer
efus05218  Melanoma
efus05219  Bladder cancer
efus05220  Chronic myeloid leukemia
efus05221  Acute myeloid leukemia
efus05223  Non-small cell lung cancer
efus05224  Breast cancer
efus05225  Hepatocellular carcinoma
efus05226  Gastric cancer
efus05230  Central carbon metabolism in cancer
efus05231  Choline metabolism in cancer
efus05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
efus05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:efus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103285154 (KRAS)
   04012 ErbB signaling pathway
    103285154 (KRAS)
   04014 Ras signaling pathway
    103285154 (KRAS)
   04015 Rap1 signaling pathway
    103285154 (KRAS)
   04370 VEGF signaling pathway
    103285154 (KRAS)
   04371 Apelin signaling pathway
    103285154 (KRAS)
   04068 FoxO signaling pathway
    103285154 (KRAS)
   04072 Phospholipase D signaling pathway
    103285154 (KRAS)
   04071 Sphingolipid signaling pathway
    103285154 (KRAS)
   04151 PI3K-Akt signaling pathway
    103285154 (KRAS)
   04150 mTOR signaling pathway
    103285154 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103285154 (KRAS)
   04137 Mitophagy - animal
    103285154 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103285154 (KRAS)
   04218 Cellular senescence
    103285154 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103285154 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103285154 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103285154 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103285154 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    103285154 (KRAS)
   04660 T cell receptor signaling pathway
    103285154 (KRAS)
   04662 B cell receptor signaling pathway
    103285154 (KRAS)
   04664 Fc epsilon RI signaling pathway
    103285154 (KRAS)
   04062 Chemokine signaling pathway
    103285154 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103285154 (KRAS)
   04929 GnRH secretion
    103285154 (KRAS)
   04912 GnRH signaling pathway
    103285154 (KRAS)
   04915 Estrogen signaling pathway
    103285154 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    103285154 (KRAS)
   04917 Prolactin signaling pathway
    103285154 (KRAS)
   04921 Oxytocin signaling pathway
    103285154 (KRAS)
   04926 Relaxin signaling pathway
    103285154 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    103285154 (KRAS)
   04919 Thyroid hormone signaling pathway
    103285154 (KRAS)
   04916 Melanogenesis
    103285154 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103285154 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103285154 (KRAS)
   04726 Serotonergic synapse
    103285154 (KRAS)
   04720 Long-term potentiation
    103285154 (KRAS)
   04730 Long-term depression
    103285154 (KRAS)
   04722 Neurotrophin signaling pathway
    103285154 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103285154 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103285154 (KRAS)
   04213 Longevity regulating pathway - multiple species
    103285154 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103285154 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103285154 (KRAS)
   05206 MicroRNAs in cancer
    103285154 (KRAS)
   05205 Proteoglycans in cancer
    103285154 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    103285154 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103285154 (KRAS)
   05203 Viral carcinogenesis
    103285154 (KRAS)
   05230 Central carbon metabolism in cancer
    103285154 (KRAS)
   05231 Choline metabolism in cancer
    103285154 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103285154 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103285154 (KRAS)
   05212 Pancreatic cancer
    103285154 (KRAS)
   05225 Hepatocellular carcinoma
    103285154 (KRAS)
   05226 Gastric cancer
    103285154 (KRAS)
   05214 Glioma
    103285154 (KRAS)
   05216 Thyroid cancer
    103285154 (KRAS)
   05221 Acute myeloid leukemia
    103285154 (KRAS)
   05220 Chronic myeloid leukemia
    103285154 (KRAS)
   05218 Melanoma
    103285154 (KRAS)
   05211 Renal cell carcinoma
    103285154 (KRAS)
   05219 Bladder cancer
    103285154 (KRAS)
   05215 Prostate cancer
    103285154 (KRAS)
   05213 Endometrial cancer
    103285154 (KRAS)
   05224 Breast cancer
    103285154 (KRAS)
   05223 Non-small cell lung cancer
    103285154 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103285154 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    103285154 (KRAS)
   05161 Hepatitis B
    103285154 (KRAS)
   05160 Hepatitis C
    103285154 (KRAS)
   05163 Human cytomegalovirus infection
    103285154 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103285154 (KRAS)
   05165 Human papillomavirus infection
    103285154 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103285154 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103285154 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    103285154 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103285154 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103285154 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103285154 (KRAS)
   01522 Endocrine resistance
    103285154 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:efus04131]
    103285154 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:efus04031]
    103285154 (KRAS)
Membrane trafficking [BR:efus04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103285154 (KRAS)
GTP-binding proteins [BR:efus04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103285154 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 103285154
NCBI-ProteinID: XP_054575190
LinkDB
Position
7:74547162..74589652
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtttttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system