Eucalyptus grandis (rose gum): 104435709 Help Entry 104435709         CDS       T03547                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism egr  Eucalyptus grandis (rose gum) Pathway egr03010   Ribosome egr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:egr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     104435709   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104435709  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:egr03011]     104435709    04121 Ubiquitin system [BR:egr04121]     104435709   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egr04147]     104435709 Ribosome [BR:egr03011]  Ribosomal proteins   Eukaryotes    Small subunit     104435709   Archaea     104435709 Ubiquitin system [BR:egr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104435709 Exosome [BR:egr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104435709   Exosomal proteins of colorectal cancer cells    104435709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD Plexin_RBD Sde2_N_Ubi OTU1_UBXL Motif Other DBs NCBI-GeneID:  104435709 NCBI-ProteinID:  XP_010046715 LinkDB All DBs Position 1:27278283..27278593 Genome browser AA seq 78 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQGKEGIPPDQQRLIFAGKQLDNGRTLADYN IQKESTLHLVLRLRGGGF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctcgaggtcgagagctcc gacaccatcgacaacgtcaaggccaagatccagggcaaggagggcatccctcccgaccag cagcgcctcatcttcgccggcaagcagctcgacaacggccgcaccctcgccgactacaac atccagaaggagtccaccctccacctcgtgctcaggctccgcggtggcggtttctga

DBGET integrated database retrieval system