KEGG   Eucalyptus grandis (rose gum): 104441490Help
Entry
104441490         CDS       T03547                                 

Definition
(RefSeq) thymidine kinase a
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    104441490
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104441490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 279 aa AA seqDB search
MSSLLRMKTLISPTFAAFSPRLSRPTFSLPLSSSNSSIFALKNSNFRSLRLKPCSGKPAI
RCLHGSPQMGAPRSPSSGEVHVIVGPMFAGKTTSLLRRIELESSSGRSVAVIKSSKDTRY
GLDSIVTHDGVKFPCLALKDLSSFKETFGLNAYDQLDVIGIDEAQFFEDLYDFCREAADC
DGKILVVAGLDGDYLRRSFGSVLDIIPLADSVTKLSARCELCGKRAYFTLRKTGETQTEV
IGGADVYMPVCRQHYVSGQAVIETTRIVLESQPQKVQCG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcttctgaggatgaagactctcatctccccaaccttcgcagcgttctcccct
cgcctgtccagacccaccttctctcttcctctctcttcctccaattcgtcgatcttcgct
cttaaaaattcgaactttcgcagcctccggctcaaaccatgctcgggcaagcccgccatt
cgctgcctccatgggagcccgcaaatgggtgctcctcgctcgccctcttccggcgaggtc
cacgtcatcgtgggcccaatgttcgccgggaagacaaccagcctgcttcggcggatcgag
ttagagagcagcagcgggagaagcgtagctgttatcaaatcaagcaaggatacaagatat
ggattggattctatcgtgactcatgatggggtgaaattcccgtgtttggcgttgaaagat
ttgtcttcatttaaagaaacattcggccttaatgcttatgatcagctagatgtcattggt
atagatgaagctcaattttttgaggacctttatgacttttgccgtgaagctgctgattgt
gatggcaagattctagtggttgctgggctggacggtgactatttgaggaggagttttggt
tctgtgctcgacataattcctttagccgattctgtcaccaagttgagtgcccgatgtgaa
ctttgtggaaaacgtgcttacttcacccttagaaagaccggtgagacgcagacagaagta
attggtggtgccgatgtatacatgcccgtttgccggcagcactatgtaagcgggcaagcg
gtcattgagacgacaagaatagtcctagaatctcagcctcagaaggtccagtgtgggtaa

DBGET integrated database retrieval system