KEGG   Eucalyptus grandis (rose gum): 104448531Help
Entry
104448531         CDS       T03547                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:egr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    104448531
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104448531
Enzymes [BR:egr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     104448531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 965 aa AA seqDB search
MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPQKLEELGNVLTSLDPGDSIVIAKSFSNMLNLANLAEEVQIAYRRRNK
LKKGDFADENNATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRS
LLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRVRADELHSSSKRDAKHYIEFWKQVP
PNEPYRVILGDLRDKLYQTRERSRQLLASGISDIPEEAAFTNAEQLLEPLELCYRSLCSC
GDRPIADGTLLDFLRQVSTFGFALVKLDIRQESDRHTDVLDAITRHLEIGSYREWSEERR
QEWLLSELSGKRPLFGPDLPQTDEIADVLNTFHVIAELPADSFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLDTAPAAVARLFSIDWYRNRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPNAPKPEWRALMDEMAVVATE
EYRSIVFKEPRFVEYFRLATPEMEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIEKDIRNLHMLQEMYNSWPFFRVTIDLVEMVFAKGNPGIAALYDK
LLVSDDLWSFGERLRSDYEETKKLLLQVAGHKDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLKRIRDPTYNVELRPHISKEIMESSNPANELVKLNPTSDYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcggaatctggagaagctggcgtccatcgatgcgcagctcaggctcctggtc
ccggcgaaggtgagcgaggacgacaagttggtggagtacgacgccctgctgctggatcgg
ttcctcgatatcctccaggacttgcacggcgaggatctcaaggagacggtacaagagtgc
tatgagctttctgctgagtatgaaggcaaacatgatcctcaaaagctggaggagctgggc
aatgtcttgaccagtttggatcctggggattccattgttattgccaaatccttctccaac
atgcttaacttggcgaacttggctgaggaggttcagattgcttaccgccggcgtaacaag
ttgaagaagggggattttgctgatgagaacaatgcaacaactgagtctgacatcgaagag
acgctcaagaggcttgtggtgcagctgaagaagtctcctgaagaagtgtttgatgctctt
aagaatcaaacggtggatcttgtcttcactgctcaccctacgcagtcagtacggagatct
ttgcttcagaagcatggaaggatccgagattgtttggcccaactctacgcgaaagacatc
actcctgatgacaagcaggagcttgatgaagcacttcagagagagatacaagctgccttc
cgtacagatgaaatccgaaggacccctccgactccacaagatgagatgagagctggaatg
agctatttccatgaaaccatatggaagggtgttcccaagttcttacgccgggttgacact
gctttgaagaacataggaatcaatgagcgtgttccttataatgcacctcttattcaattt
tcttcctggatgggtggcgatcgtgatggtaatccaagagtaacccctgaggtcacgaga
gacgtttgcttattagctagaatgatggctgccaacttgtactattcccaaattgaagat
cttatgtttgagctgtctatgtggcgttgcagtgatgagttacgtgttcgtgcggatgaa
ctccattcatcctcaaaaagagatgcaaaacactatatagagttttggaaacaagtacca
ccaaatgaaccctaccgtgtgatacttggtgatttgagggataagctgtatcagacacgt
gaacgttctcgtcaattattagccagtggtatctccgacatccccgaagaggcagctttc
accaatgctgagcagctcttggaacctctggaactttgctacagatcactctgctcatgt
ggtgatcggccaatagctgatggaacccttcttgatttcttgagacaagtttccactttt
ggctttgcacttgtcaaacttgatattagacaagaatccgacagacacactgatgtatta
gatgcgataacaaggcacttggaaattgggtcctacagggagtggtctgaagagcgccga
caggaatggctcttgtctgagctcagcggcaagcgcccactctttggtcctgatcttcct
caaactgatgaaatcgcggatgtgctaaacacattccatgtcatagcagagctccctgct
gatagctttggggcctatatcatctcgatggccactgctccatctgatgtgctggcagta
gagctcttacaacgtgagtgccatgtgaagcaacccctgagagttgttccactgtttgag
aagctcgcagatcttgatactgctcctgctgctgtggcacgacttttctcaattgattgg
tacagaaatcggatcaatggcaagcaggaagttatgattggctattcagattctggcaag
gatgctggacgcttttctgcagcatggcagctatataaggctcaggaagagcttataaaa
gttgctaaacagtttggcgtgaagcttactatgttccatggtcgtggtggcacggtcggg
agaggaggtggtcccacccatcttgccatattgtctcagccaccagacactattcacggg
tcacttcgtgttacagttcagggtgaggttattgagcaatcatttggagaggagcatttg
tgctttagaactctgcaacgttttaccgctgctaccctagagcatgggatgcacccacca
aatgccccgaaacctgaatggcgtgcgctgatggatgagatggctgttgtggctacagaa
gagtaccgctcaattgttttcaaagagcctcgttttgtcgagtactttcgccttgccacc
ccagagatggaatacggtcgtatgaacattgggagccgtccagcaaagcgaaagcccagc
ggaggcattgagtcacttcgtgcaatcccttggatttttgcatggactcaaacaaggttt
caccttccagtgtggcttggttttggggccgccttcaagcatgttattgagaaggacatt
cggaatctgcatatgctgcaggagatgtacaactcgtggcctttctttagagtcaccatt
gacttggttgaaatggtgtttgccaagggtaatcctggaatagccgccttgtatgacaaa
ctccttgtctctgatgatctttggtcattcggggagcgcttgaggtccgattatgaagaa
acaaagaaacttcttctccaggttgctggtcacaaggatcttctggaaggggacccctac
ctgaagcagagattgcgcctccgcgattcatacatcacaactctaaacgtttgccaagcg
tacacactcaaacggatccgagacccaacctacaatgtggagttgcggcctcacatctct
aaggagatcatggagtcgagcaacccggccaatgagctcgtgaagttgaacccgacgagt
gactacgcccccggtctggaggataccctcatcttgaccatgaagggtattgccgctggc
ctgcagaacaccggctaa

DBGET integrated database retrieval system