KEGG   Elaeis guineensis (African oil palm): 105041203Help
Entry
105041203         CDS       T03921                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:egu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105041203
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105041203
Enzymes [BR:egu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     105041203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 180 aa AA seqDB search
MASSMMVSSAATASRATPAQSSMVAPFTGLKSTSAFPATRRASNGFSKLPSNGGRVQCMK
VWPIEGLKKFETLSYLPPLSIEALLKQIEYLLRSGWIPCLEFCKVGFVSRDNNRSPGYYD
GRYWTMWKLPMFGCNDATQVAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKPPSY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgatggtctcttctgccgctactgcgtcccgggccaccccagcccaa
tccagcatggtcgcacccttcaccggcctcaagtcgacctccgccttcccggccacaagg
agggcaagcaacggcttctcaaagcttccaagcaacggaggcagggttcagtgcatgaag
gtctggccgatcgagggactgaagaagttcgagaccctctcttaccttccgcctctctcc
atcgaggctttgctcaagcaaattgagtaccttctccgtagtggatggattccttgcttg
gagttctgcaaagttggctttgtgtcccgtgacaacaaccgatcccctggatactacgat
ggacgctactggaccatgtggaaattgcccatgttcggctgcaacgatgccacccaggtc
gcgaaggagcttgaggagtgcaagaaagaatacccggacgcattcatccggatcattgga
ttcgacaatgttcgccaagttcagtgcatcagtttcatcgcctacaagcccccaagctac
taa

DBGET integrated database retrieval system