KEGG   Egretta garzetta (little egret): 104124809Help
Entry
104124809         CDS       T05152                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:egz00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    104124809 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    104124809 (SOD2)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104124809 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MLCRLASGGRSGAKLIAPLGCLVSRQKHTLPDLPYDYGALEPHINAEIMQLHHSKHHATY
VNNLNVAEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELM
EAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQIAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENISSRYATCKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgcctcgcctcggggggcagaagcggcgccaagttgatagcaccattgggg
tgcttggtctctaggcagaagcacacacttcctgacttgccatatgactatggcgctctg
gaacctcatattaacgcagagatcatgcagctgcaccacagcaagcatcatgccacctac
gtgaacaacctgaatgttgcagaggagaaatataaagaagcactggcaaaaggtgatgtt
acagctcaagtgtcacttcagcctgcactgaagttcaatggcgggggtcatatcaatcac
accatcttctggacaaacctttctcctaatggaggaggagagcctaaaggagaactgatg
gaagccatcaagcgtgactttggttccttcgcgaacttcaaggagaagctgacagccgta
tcagttggtgttcaaggatcgggctgggggtggcttggctataacaaagagcaggggcgc
ctacaaatagcagcttgtgcaaatcaagaccctttgcaaggaacaacaggtcttattcct
ttgctaggaattgacgtatgggaacacgcttattatcttcagtataaaaatgttcgacct
gattatttgaaagccatctggaatgtgatcaactgggagaatatatcttcaagatacgca
acttgcaaaaagtag

DBGET integrated database retrieval system