Eurypyga helias (sunbittern): 104507894 Help Entry 104507894         CDS       T08356                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04010   MAPK signaling pathway ehs04012   ErbB signaling pathway ehs04068   FoxO signaling pathway ehs04137   Mitophagy - animal ehs04140   Autophagy - animal ehs04144   Endocytosis ehs04150   mTOR signaling pathway ehs04210   Apoptosis ehs04218   Cellular senescence ehs04370   VEGF signaling pathway ehs04371   Apelin signaling pathway ehs04510   Focal adhesion ehs04540   Gap junction ehs04625   C-type lectin receptor signaling pathway ehs04810   Regulation of actin cytoskeleton ehs04910   Insulin signaling pathway ehs04912   GnRH signaling pathway ehs04916   Melanogenesis ehs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104507894 (HRAS)    04012 ErbB signaling pathway     104507894 (HRAS)    04370 VEGF signaling pathway     104507894 (HRAS)    04371 Apelin signaling pathway     104507894 (HRAS)    04068 FoxO signaling pathway     104507894 (HRAS)    04150 mTOR signaling pathway     104507894 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104507894 (HRAS)    04140 Autophagy - animal     104507894 (HRAS)    04137 Mitophagy - animal     104507894 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104507894 (HRAS)    04218 Cellular senescence     104507894 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104507894 (HRAS)    04540 Gap junction     104507894 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104507894 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104507894 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104507894 (HRAS)    04912 GnRH signaling pathway     104507894 (HRAS)    04916 Melanogenesis     104507894 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104507894 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehs04131]     104507894 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehs04147]     104507894 (HRAS)    04031 GTP-binding proteins [BR:ehs04031]     104507894 (HRAS) Membrane trafficking [BR:ehs04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104507894 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104507894 (HRAS) Exosome [BR:ehs04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104507894 (HRAS)   Exosomal proteins of colorectal cancer cells    104507894 (HRAS) GTP-binding proteins [BR:ehs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104507894 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  104507894 NCBI-ProteinID:  XP_010147628 UniProt:  A0A093IU36 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgtcgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgacggagagacctgcttgttagacatcttggataccgcgggg caagaggagtacagtgccatgagagaccagtacatgaggacgggggaaggattcctctgc gtctttgctatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactccgatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttacgggattccc tacatagaaacgtctgccaaaaccagacagggcgtggaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system