Eumetopias jubatus (Steller sea lion): 114220346 Help Entry 114220346         CDS       T07240                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju01523   Antifolate resistance eju04010   MAPK signaling pathway eju04014   Ras signaling pathway eju04024   cAMP signaling pathway eju04062   Chemokine signaling pathway eju04064   NF-kappa B signaling pathway eju04066   HIF-1 signaling pathway eju04071   Sphingolipid signaling pathway eju04137   Mitophagy - animal eju04151   PI3K-Akt signaling pathway eju04210   Apoptosis eju04211   Longevity regulating pathway eju04218   Cellular senescence eju04380   Osteoclast differentiation eju04613   Neutrophil extracellular trap formation eju04620   Toll-like receptor signaling pathway eju04621   NOD-like receptor signaling pathway eju04622   RIG-I-like receptor signaling pathway eju04623   Cytosolic DNA-sensing pathway eju04625   C-type lectin receptor signaling pathway eju04657   IL-17 signaling pathway eju04658   Th1 and Th2 cell differentiation eju04659   Th17 cell differentiation eju04660   T cell receptor signaling pathway eju04662   B cell receptor signaling pathway eju04668   TNF signaling pathway eju04722   Neurotrophin signaling pathway eju04917   Prolactin signaling pathway eju04920   Adipocytokine signaling pathway eju04926   Relaxin signaling pathway eju04931   Insulin resistance eju04932   Non-alcoholic fatty liver disease eju04933   AGE-RAGE signaling pathway in diabetic complications eju04936   Alcoholic liver disease eju05010   Alzheimer disease eju05022   Pathways of neurodegeneration - multiple diseases eju05030   Cocaine addiction eju05132   Salmonella infection eju05133   Pertussis eju05134   Legionellosis eju05135   Yersinia infection eju05140   Leishmaniasis eju05142   Chagas disease eju05145   Toxoplasmosis eju05146   Amoebiasis eju05152   Tuberculosis eju05160   Hepatitis C eju05161   Hepatitis B eju05162   Measles eju05163   Human cytomegalovirus infection eju05164   Influenza A eju05165   Human papillomavirus infection eju05166   Human T-cell leukemia virus 1 infection eju05167   Kaposi sarcoma-associated herpesvirus infection eju05168   Herpes simplex virus 1 infection eju05169   Epstein-Barr virus infection eju05170   Human immunodeficiency virus 1 infection eju05171   Coronavirus disease - COVID-19 eju05200   Pathways in cancer eju05202   Transcriptional misregulation in cancer eju05203   Viral carcinogenesis eju05207   Chemical carcinogenesis - receptor activation eju05208   Chemical carcinogenesis - reactive oxygen species eju05212   Pancreatic cancer eju05215   Prostate cancer eju05220   Chronic myeloid leukemia eju05221   Acute myeloid leukemia eju05222   Small cell lung cancer eju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer eju05321   Inflammatory bowel disease eju05415   Diabetic cardiomyopathy eju05417   Lipid and atherosclerosis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114220346 (RELA)    04014 Ras signaling pathway     114220346 (RELA)    04064 NF-kappa B signaling pathway     114220346 (RELA)    04668 TNF signaling pathway     114220346 (RELA)    04066 HIF-1 signaling pathway     114220346 (RELA)    04071 Sphingolipid signaling pathway     114220346 (RELA)    04024 cAMP signaling pathway     114220346 (RELA)    04151 PI3K-Akt signaling pathway     114220346 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     114220346 (RELA)   09143 Cell growth and death    04210 Apoptosis     114220346 (RELA)    04218 Cellular senescence     114220346 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114220346 (RELA)    04620 Toll-like receptor signaling pathway     114220346 (RELA)    04621 NOD-like receptor signaling pathway     114220346 (RELA)    04622 RIG-I-like receptor signaling pathway     114220346 (RELA)    04623 Cytosolic DNA-sensing pathway     114220346 (RELA)    04625 C-type lectin receptor signaling pathway     114220346 (RELA)    04660 T cell receptor signaling pathway     114220346 (RELA)    04658 Th1 and Th2 cell differentiation     114220346 (RELA)    04659 Th17 cell differentiation     114220346 (RELA)    04657 IL-17 signaling pathway     114220346 (RELA)    04662 B cell receptor signaling pathway     114220346 (RELA)    04062 Chemokine signaling pathway     114220346 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     114220346 (RELA)    04917 Prolactin signaling pathway     114220346 (RELA)    04926 Relaxin signaling pathway     114220346 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     114220346 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     114220346 (RELA)   09149 Aging    04211 Longevity regulating pathway     114220346 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114220346 (RELA)    05202 Transcriptional misregulation in cancer     114220346 (RELA)    05207 Chemical carcinogenesis - receptor activation     114220346 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     114220346 (RELA)    05203 Viral carcinogenesis     114220346 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     114220346 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     114220346 (RELA)    05221 Acute myeloid leukemia     114220346 (RELA)    05220 Chronic myeloid leukemia     114220346 (RELA)    05215 Prostate cancer     114220346 (RELA)    05222 Small cell lung cancer     114220346 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     114220346 (RELA)    05170 Human immunodeficiency virus 1 infection     114220346 (RELA)    05161 Hepatitis B     114220346 (RELA)    05160 Hepatitis C     114220346 (RELA)    05171 Coronavirus disease - COVID-19     114220346 (RELA)    05164 Influenza A     114220346 (RELA)    05162 Measles     114220346 (RELA)    05168 Herpes simplex virus 1 infection     114220346 (RELA)    05163 Human cytomegalovirus infection     114220346 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     114220346 (RELA)    05169 Epstein-Barr virus infection     114220346 (RELA)    05165 Human papillomavirus infection     114220346 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     114220346 (RELA)    05135 Yersinia infection     114220346 (RELA)    05133 Pertussis     114220346 (RELA)    05134 Legionellosis     114220346 (RELA)    05152 Tuberculosis     114220346 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     114220346 (RELA)    05145 Toxoplasmosis     114220346 (RELA)    05140 Leishmaniasis     114220346 (RELA)    05142 Chagas disease     114220346 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     114220346 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     114220346 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     114220346 (RELA)   09165 Substance dependence    05030 Cocaine addiction     114220346 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114220346 (RELA)    05418 Fluid shear stress and atherosclerosis     114220346 (RELA)    05415 Diabetic cardiomyopathy     114220346 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     114220346 (RELA)    04932 Non-alcoholic fatty liver disease     114220346 (RELA)    04931 Insulin resistance     114220346 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     114220346 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     114220346 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:eju03000]     114220346 (RELA) Transcription factors [BR:eju03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     114220346 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  114220346 NCBI-ProteinID:  XP_027973954 LinkDB All DBs Position Unknown AA seq 539 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQSYPFTPSLSTINF EEFSPMVFSSGQIPNQTSALAPAPAPILAPAPAPAPAPILAPGLAQAVVPPAPKTTQAGE GTLSEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPM LMEYPEAITRLVTGSQRPPDPTPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcctgcccaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctccgccggcagtatcccgggcgagaggagcactgataccaccaagacccaccccacc atcaagatcaatggctacactgggccagggacagttcgcatctccctggtcaccaaggac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcgactctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct catcccatctttgacaaccgtgcccccaataccgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtatatttcaccggaccaggctgggaggcccgaggctccttttct caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgctgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagcacaacttcc gttcccaagccagctccccagtcctatccctttacgccgtccctcagcaccatcaacttc gaggagttctcccccatggtcttttcttcggggcagatcccaaaccagacctctgccttg gccccggcccctgccccaatcctggccccagcccctgccccagcccctgccccaatctta gccccaggccttgctcaggctgtggtccccccagcccccaagaccacccaggccggggaa gggacgctgtcagaggccctgctgcagctgcagtttgatgccgacgaagacctgggggcc ctgctgggcaacagcgctgaccccgccgtgttcacagacctggcatccgttgacaactct gagtttcagcagctcctgaaccagggtgtatctgtggccccacacacagccgagcccatg ctcatggagtaccctgaggcaataacgcgcctggtgacagggtcccagaggccccctgat ccaactcctgctcccctaggggcctctgggctccccaacggcctcctctcaggggatgaa gacttctcctccatcgcagatatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system