KEGG   Eutypa lata: UCREL1_5169Help
Entry
UCREL1_5169       CDS       T03103                                 

Definition
(RefSeq) putative cysteine sulfinic acid decarboxylase protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ela  Eutypa lata
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UCREL1_5169
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCREL1_5169
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCREL1_5169
   00430 Taurine and hypotaurine metabolism
    UCREL1_5169
Enzymes [BR:ela01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCREL1_5169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MDGPHLYKRLFCPKDKAALLNRAEEVEDLIDAVKALIIPFIRAADTSAPERAAGVTSPDA
SCTALVDSYKPEVLVEKLRFSLPEGDGRGKDGLLDTIQDVLRYSVNTWDQGFLDKLYSST
NAVGVVAELLLAVLNTNVHVYAVAPALTVIEKTTARQLARLFGFAGPRAGGIVCQGGSAS
NMTSIVVARNTLYPSTKAVGNAGHQFVLFTSEHGHYSVEKAAITCGMGSANVITIPVDAS
GRISPAALRSAILQAKSEGKTPLYVNATAGTTVLGSFDPFEAISAVCREFGLWMHVDASW
GGAAVFSSRQRDKLGGAHLAHSLTVNPHKMLGVPVTCSFLLTPDLAVFHRANTLPAGYLF
HGGGGGGGDDDDDDDVEDEKTQHVEEQEGEGTDDDDDYDDVWDLADLTLQCGRRGDGLKL
ALAWVFYGAAGFEAQVDGAFETAAHLATLIRDSADFELLSSSPPPCLQVCFYYAPGGVVS
PDGAENTRRTRMMVARLVRRGFMIDYAPGERGSFFRVVVNVQTLRGTVEGLLKALRDVGR
EVVRE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggatggccctcacttgtataagaggctattttgccctaaggacaaagcagcactcctg
aatcgtgcagaagaagttgaggatttaatcgacgcggtcaaagccctcatcatccccttc
atccgggccgcagacacctcagcccctgaacgggcagcaggggtaacgtcgccggatgct
tcatgcacagctctcgtagactcctacaagcccgaggtgctcgtagagaaactacgcttc
tcgctgccagaaggcgacggcaggggcaaagacgggctactggacacaatccaagatgtg
ctccgctacagcgtgaatacgtgggatcaggggttcctcgataaactgtactcgagcacc
aatgcggtcggtgtagtagcagagctactgcttgctgtcctgaatacaaatgtacacgta
tacgccgtcgcgcccgcactcacggtgatcgagaagacgacggcgcggcagctcgcgcgc
ctattcgggttcgcggggccacgagccggcgggatcgtctgtcaaggcgggtcagcgtcg
aacatgacgtcgatcgtggttgctcggaacacgctgtatccctctactaaggcagttgga
aacgcaggccaccaatttgtcctattcacgagtgagcacgggcactatagcgtcgagaag
gccgccatcacgtgtgggatgggatccgccaacgtgataaccatccccgtcgacgcctca
ggccgcatatcgcccgcggccctccgaagcgccatcctccaagccaaaagcgagggcaag
acgccgttgtacgtgaacgcgacggcggggacgacagtcctggggtccttcgaccccttc
gaggccatctccgccgtctgccgcgaattcgggctctggatgcacgtggacgcgtcctgg
ggcggcgcggcggtcttctcctcgcggcagcgggacaagctcggcggcgcccacctcgcc
cacagcctcaccgtcaacccacacaagatgctcggcgtccccgtcacgtgctcgttcctt
ctaacgcccgatctcgccgtcttccaccgcgcgaacacgctgcccgcggggtacctgttc
catgggggtggtggtggtggtggcgacgatgatgatgatgatgatgtagaagatgagaag
acacaacacgtggaggagcaggagggagagggaacagatgatgatgatgattatgatgat
gtctgggacctcgcagacctaacgctgcaatgcggccggcgcggggacggcctcaagctc
gccctagcgtgggtgttctacggcgcggcggggttcgaggcgcaggtcgacggggccttc
gagacggcggcccacctcgcgacgctcatacgggactcggccgacttcgagctcctgtcg
agcagcccgccgccgtgcctgcaggtgtgcttctactacgcgccgggcggggtggtgagt
cccgacggggccgagaacacgcggcggacgaggatgatggtggcgcggctggtccggagg
gggttcatgatcgattacgcccccggggagaggggcagcttcttccgcgtcgtggttaat
gtccagacgctgaggggcactgtggaggggctgctgaaggcgttgcgggatgtggggagg
gaggttgtgagggagtga

DBGET integrated database retrieval system