KEGG   Escherichia coli clone D i2: i02_4453Help
Entry
i02_4453          CDS       T02004                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eld  Escherichia coli clone D i2
Brite
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     i02_4453 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4442294..4442920
Genome map
AA seq 208 aa AA seqDB search
MNMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELI
TKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFE
KAAASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagttataccctgccatccctgccgtatgcttacgatgccctggaaccgcac
ttcgataagcagaccatggaaatccaccacaccaaacaccatcagacttacgtcaacaac
gccaacgcggcgctggaaaacctgccagaatttgccaacctgccggttgaagagctgatc
accaaactggaccagctgccagcagacaagaaaaccgtactgcgcaataacgctggtggt
cacgctaaccacagtctgttctggaaaggtctgaaaaaaggcaccaccctgcagggcgac
ctgaaagcggctatcgaacgtgatttcggttccgttgataatttcaaagcagaatttgaa
aaagcggcagcttcccgctttggttccggctgggcatggctggtgcaaaaaggcgataaa
ctggcggtggtttctactgctaaccaggactctccactgatgggcgaagccatttctggc
gcttccggcttcccgattctgggcctggatgtgtgggaacatgcttactatctgaaattc
cagaaccgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagca
gcggcacgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system