KEGG   Escherichia coli LF82: LF82_2147Help
Entry
LF82_2147         CDS       T00854                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
elf  Escherichia coli LF82
Brite
Enzymes [BR:elf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LF82_2147 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4165375..4165995
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacttacgtcaacaacgccaac
gcggcgctggaaaacctgccagaatttgccaacctgccggttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaataacgctggtggtcacgct
aaccacagtctgttctggaaaggtctgaaaaaaggcaccaccctgcagggcgacctgaaa
gcggctatcgaacgtgatttcggttccgttgataatttcaaagcagaatttgaaaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgcaaaaaggcgataaactggcg
gtggtttctactgctaaccaggactctccactgatgggcgaagccatttctggcgcttcc
ggcttcccgattctgggcctggatgtgtgggaacatgcttactatctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system