KEGG   Erythrobacter litoralis HTCC2594: ELI_00525Help
Entry
ELI_00525         CDS       T00315                                 

Definition
(GenBank) Putative phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_00525
  Energy metabolism
   00680 Methane metabolism
    ELI_00525
Enzymes [BR:eli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ELI_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(134871..137633)
Genome map
AA seq 920 aa AA seqDB search
MKSVTDLRERLQDMHSRTAETPLFNPVFQLSLDLSRALEAGELSLDDLESMICELETTAL
EDRAARTRRLLALPGTDTWRLGPDFADFGAFREHWEQPRLHAVFTAHPTFLLTPDQASSL
ASAITGDGSVADAACTATEDRPAVTLVYEHQRAMRAIGHAQDARDRIVGELLSNAAVSFA
DRWRDLKPLPFRFATWVGYDMDGRTDIKWYDSIGFRLAEKAQRLRRYVAKLEKIDSGHKL
LGTLHPALAYAEARAEDFAQDLSDPVDLSDAANRLTADHEHKLLSLAPIIAALEEEAQQA
SEDHAIKLLTLAAAMRADGLGMGWIHFRVNAKQLHNAIRRRIEGGDTLEIGSKGAMAVLR
KMVAEVEPMRANFGALAIEASTAIRQFLAMAQILHHIDADAPIRMLVAECEQPSTVMAAL
YFAKLFGIADKVDVSPLFETEAALEHGGRFLDALLQEDEYRAYARNRGRVCIQTGFSDAG
RFVGQVPASLAIERLQGRMADAMRANAMSDVAALVFNTHGESMGRGAHPASLKDRLEWPL
SPWARGRFARGSVRLEPEASFQGGDGYQLFETPELAFATLAHIADYEWTEHASGEPDPFY
TRTDLSLDFYRAIRTHQREHLESQTYSRAITAFGLGMLNSTGSRVSRRQSDVAADRSMNL
RQIRAIPHNAILQQLGYPVNVIAGIGTAAEGNEEEIAQLLESSPRGQQLMRLARNANALA
SIKTVAAYGELFNSAYWASRTYRGTEDGISHACQALADYLTKDDRNGVFRRLASRLRVDA
LKFHRLLEHLPAEDPLPEREQTRRTLGVLQALRLALFKHMFLRAVSLPSFSRANDISRDD
VLEMVFTLRIDDALAQMRRAFPTSFPQLDDFQMDEPSDWPDDEGEGYGAIGRNYIDPLER
AYMLSLRVTTAIANHFGAHG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgtcaccgaccttcgcgagcgcctgcaggacatgcacagccggacagcggaa
accccgctgttcaacccggtgttccagctatcgctcgacctttcgcgcgctcttgaggcg
ggcgaattgtcgctcgacgatctcgaaagcatgatctgcgagctggaaacgacggcgctg
gaagatcgcgctgcgcgcacgcggcgcttgctcgccctgcccggcacggacacttggcgg
cttggccccgattttgccgatttcggcgcgttccgtgagcattgggagcagccgcgcctg
cacgcggttttcactgcgcacccgacatttctgctgacgcccgaccaggccagctcgctt
gccagtgcgatcaccggcgacgggagtgtcgccgatgccgcctgcaccgcgaccgaggac
cgtccggctgtcactctagtctacgagcaccagcgtgcgatgcgcgccatcggccatgcg
caggacgcgcgcgaccggatcgtcggcgaattgctatccaatgcggccgtcagtttcgcc
gaccggtggcgggacctgaagccgctgccgttccgcttcgcaacttgggtcggctacgac
atggacgggcgcaccgacatcaagtggtacgattccattggttttcggctggcggaaaaa
gcccaacgtctgcgccgctatgtcgcaaagctggaaaagatcgacagcgggcacaagctg
ctcggcacgctgcaccccgccctcgcctatgccgaagcgcgcgccgaggacttcgcgcag
gacctcagcgatccggtcgatctcagcgatgccgccaaccgcctgaccgccgatcacgag
cacaagctgctcagcctcgcgccaatcatcgccgcgctggaagaggaagcgcaacaggca
tccgaagatcacgcgatcaaactgctgaccctcgccgccgcgatgcgcgccgacgggctg
ggcatgggctggatacattttcgggtgaacgccaagcagctccacaacgccattcgccgc
cgcatcgaaggcggcgatacgctggagatcggcagcaagggtgcgatggcggtgctgcgc
aagatggtcgccgaagtcgaacccatgcgcgccaacttcggcgcgctcgcgatcgaggcc
agcacggcgatccgccagttcctcgccatggcgcagatcctgcaccatatcgatgccgat
gcgccgatccgcatgctggtggccgaatgcgagcagccctccaccgtcatggccgcgctc
tatttcgccaagctcttcggcattgcggacaaggtcgatgtctccccactgttcgaaacc
gaagcggcgctggagcatggcgggcggttcctcgatgcgctgctgcaggaagacgaatac
cgcgcctatgcccgcaaccggggccgtgtctgcatccagaccggtttttccgatgccggg
cgtttcgtcgggcaggtcccggcgagcctggccatcgagcgcctccagggccggatggcc
gacgccatgcgcgccaatgcgatgagcgatgtcgctgcgctcgtgtttaacacccatggc
gagagtatggggcgcggtgcgcatccggcctcactcaaagatcgcctcgaatggccgctg
tcgccatgggcgcggggccgcttcgcgcgcggctcggtccggctggaacccgaggccagc
ttccagggcggcgatggttaccagctgttcgagacgcccgaactcgccttcgcaacgctc
gcccatatcgccgattacgaatggaccgagcatgccagcggcgagcccgatcccttctat
acccgcaccgacctgagcctcgacttctaccgcgccatccgcacgcaccagcgcgagcat
ctcgaaagccagacctattcgcgagcgatcacggccttcgggctcggcatgctcaattcg
accggcagccgcgtcagccgccggcagagcgacgtcgccgccgaccgctcgatgaacctg
cgccagatccgcgccatcccgcacaatgcgatcctgcagcagctcggctatccggtgaac
gtcatcgccgggatcggcaccgctgccgagggcaatgaagaagaaatcgcgcagctgctg
gaatccagccctcgcgggcagcagttgatgcggctcgcgcgcaatgccaatgcgctcgcc
agcatcaagaccgtcgccgcctatggcgaactgttcaacagcgcttactgggcgagccgc
acctatcgcgggaccgaagacggcatctcgcatgcttgccaggcgttggccgattatctc
accaaggatgaccgcaacggggtattccgtcgattggcctcgcgcctgcgggtcgatgcg
ctcaagtttcaccgattgctcgagcacctgcccgcggaagacccgctaccagagcgcgag
caaacacggcgcacgctcggcgtcttgcaggcgctgcggctggcgctgttcaagcacatg
tttctgcgcgcggtatcgctccccagcttcagccgcgccaacgacatcagccgcgacgat
gtgctggaaatggtcttcaccttgcggatcgacgatgcgctggcgcagatgcggcgggcc
ttcccgaccagcttcccacagcttgacgatttccagatggatgagccgagcgactggcct
gacgacgaaggcgaaggatacggcgcgatcggacggaactatatcgacccgctggaacgc
gcctacatgctctcgctgcgcgtcacgacggcgatcgccaaccatttcggcgcgcatggc
taa

DBGET integrated database retrieval system