KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17475Help
Entry
NRG857_17475      CDS       T02068                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00250  Alanine, aspartate and glutamate metabolism
eln00410  beta-Alanine metabolism
eln00430  Taurine and hypotaurine metabolism
eln00650  Butanoate metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln02024  Quorum sensing
Module
eln_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NRG857_17475
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NRG857_17475
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NRG857_17475
   00430 Taurine and hypotaurine metabolism
    NRG857_17475
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NRG857_17475
Enzymes [BR:eln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NRG857_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 12876457
NCBI-ProteinID: YP_006121837
UniProt: A0A0H3EMU4
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(3686604..3688004)
Genome map
AA seq 466 aa AA seqDB search
MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaagctgttaacggatttccgctcagaactactcgattcacgttttggcgca
aaggccatttctactatcgcagaatcaaaacgatttccgctgcacgaaatgcgcgatgat
gttgcatttcagattatcaatgatgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcgatc
aataaaaactggatcgacaaagaagaatatccgcaatccgctgcaatcgacctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggtaagccgactaacaaaccgaacctggtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
cagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctataca
aaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system