Escherichia coli O44 H18 042 (EAEC): EC042_3466 Help Entry EC042_3466        CDS       T02067                                  Symbol secG Name (GenBank) protein-export membrane protein   KO K03075   preprotein translocase subunit SecG Organism elo  Escherichia coli O44:H18 042 (EAEC) Pathway elo02024   Quorum sensing elo03060   Protein export elo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:elo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EC042_3466 (secG)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     EC042_3466 (secG)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EC042_3466 (secG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:elo02044]     EC042_3466 (secG) Secretion system [BR:elo02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    EC042_3466 (secG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG Motif Other DBs NCBI-ProteinID:  CBG36292 UniProt:  D3GXR5 LinkDB All DBs Position complement(3691009..3691341) Genome browser AA seq 110 aa AA seqDB search MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgtacgaagctcttttagtagttttccttattgtggcaattggccttgttggtctgatc atgctgcagcaaggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgct acgctgtttggttcaagtggttctggtaacttcatgacccgcatgacggcgctgctggca acgttattcttcatcatcagtctggtgttgggtaacatcaatagcaacaaaaccaataaa ggtagcgaatgggaaaacctgagtgcgccggcgaaaaccgaacaaactcagccagctgct ccggctaagccgaccagcgatatcccgaactaa

DBGET integrated database retrieval system