KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4281Help
Entry
EC042_4281        CDS       T02067                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EC042_4281 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4571629..4572255
Genome map
AA seq 208 aa AA seqDB search
MNMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELI
TKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFE
KAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcac
ttcgataagcagaccatggaaatccaccacaccaaacaccatcagacctacgtcaacaac
gccaacgcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatc
accaaactggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggt
cacgccaaccacagcctgttctggaaaggtctgaaaaaaggcaccaccttacagggtgac
ctgaaagcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgag
aaagcggcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaa
ctggcggtggtttctactgctaaccaggattccccgctgatgggtgaagctatttctggc
gcttccggcttcccgattctgggcctggatgtgtgggaacatgcttactacctgaaattc
cagaaccgccgtccggactacatcaaagagttctggaacgtggtgaactgggacgaagca
gcggcacgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system