Esox lucius (northern pike): 105011476 Help Entry 105011476         CDS       T04894                                  Symbol rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism els  Esox lucius (northern pike) Pathway els04140   Autophagy - animal els04144   Endocytosis els04530   Tight junction Brite KEGG Orthology (KO) [BR:els00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105011476 (rab8a)    04140 Autophagy - animal     105011476 (rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     105011476 (rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105011476 (rab8a)    03036 Chromosome and associated proteins [BR:els03036]     105011476 (rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105011476 (rab8a)    04031 GTP-binding proteins [BR:els04031]     105011476 (rab8a) Membrane trafficking [BR:els04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     105011476 (rab8a)  Autophagy   Other autophagy associated proteins     105011476 (rab8a) Chromosome and associated proteins [BR:els03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     105011476 (rab8a) Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105011476 (rab8a)   Exosomal proteins of other body fluids (saliva and urine)    105011476 (rab8a)   Exosomal proteins of colorectal cancer cells    105011476 (rab8a) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     105011476 (rab8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Tor_N Phage_holin_6_1 Motif Other DBs NCBI-GeneID:  105011476 NCBI-ProteinID:  XP_010869821 UniProt:  A0A3P9AKQ7 LinkDB All DBs Position LG08:10572982..10579782 Genome browser AA seq 206 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMVLG NKCDVNDKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFMTLARDIKAKMDKKLEGN NPQGSSQGVKITEQPKKSSFFRCTLL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacgtacgattacttgtttaaactactgttaatcggcgattctggcgttgga aagacgtgtgtcttgttcaggttttcagaagatgccttcaactcaacgtttatctccaca ataggtatagactttaaaattagaacaatagaactagatggaaagaagatcaagctacag atatgggacacagctggccaggagcgatttcgaacaatcacaacagcatactacagagga gccatgggcattatgttggtctacgatatcactaacgagaagtcctttgacaacatcaag aactggataaggaatatagaggagcatgcctctgcagatgtagagaagatggtgttgggc aacaaatgtgatgtcaatgacaagcgacaggtgtccaaagaccgaggggagaagttggct ttggagtatggtatcaagtttatggagaccagtgcaaaggccaacatcaatgtggagaat gcatttatgactcttgctagagacatcaaggcgaaaatggacaagaaactggagggcaac aatccacagggcagcagtcagggggtgaagattacagaacagcccaagaagagtagtttc ttccgctgcacccttctgtag

DBGET integrated database retrieval system