Esox lucius (northern pike): 105016855 Help Entry 105016855         CDS       T04894                                  Symbol rhoa Name (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism els  Esox lucius (northern pike) Pathway els04144   Endocytosis els04150   mTOR signaling pathway els04270   Vascular smooth muscle contraction els04310   Wnt signaling pathway els04350   TGF-beta signaling pathway els04510   Focal adhesion els04520   Adherens junction els04530   Tight junction els04621   NOD-like receptor signaling pathway els04625   C-type lectin receptor signaling pathway els04810   Regulation of actin cytoskeleton els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105016855 (rhoa)    04350 TGF-beta signaling pathway     105016855 (rhoa)    04150 mTOR signaling pathway     105016855 (rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105016855 (rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105016855 (rhoa)    04520 Adherens junction     105016855 (rhoa)    04530 Tight junction     105016855 (rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105016855 (rhoa)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105016855 (rhoa)    04625 C-type lectin receptor signaling pathway     105016855 (rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105016855 (rhoa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105016855 (rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105016855 (rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105016855 (rhoa)    04031 GTP-binding proteins [BR:els04031]     105016855 (rhoa) Membrane trafficking [BR:els04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105016855 (rhoa) Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105016855 (rhoa)   Exosomal proteins of other body fluids (saliva and urine)    105016855 (rhoa)   Exosomal proteins of colorectal cancer cells    105016855 (rhoa)   Exosomal proteins of bladder cancer cells    105016855 (rhoa) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105016855 (rhoa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105016855 NCBI-ProteinID:  NP_001290623 UniProt:  C1BYI0 LinkDB All DBs Position LG17:12028768..12032468 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSRQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKQRHKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgtaagaagctggttatagtgggagatggagcatgtgggaaaacctgc ctactcattgtattcagtaaagaccagttccctgaagtctatgtgcccactgtctttgag aactatgtggctgacatcgaggtcgacagccgacaggttgagttggcactgtgggataca gcaggccaggaggactatgaccggctccgccctctgtcatacccagatactgatgtcatc cttatgtgcttctctgtcgatagcccagacagtttggaaaacatcccggagaagtggact ccggaggtcaaacacttctgccctaacgttcccatcatcctcgttggcaacaaaaaggac ctgcgtaacgatgagcatacacgccgagagttagccaagatgaaacaggagcctgtaaag cccgaggaagggcgtgacatggcaaaccggatcagtgcctttggctacatggagtgctct gcaaagacaaaagatggtgtgagggaagtgtttgagatggccaccagggctgcgctacag gcacggcgggggaaacagcgacataaatgcctcctactgtaa

DBGET integrated database retrieval system