Esox lucius (northern pike): 105017191 Help Entry 105017191         CDS       T04894                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism els  Esox lucius (northern pike) Pathway els04137   Mitophagy - animal els04140   Autophagy - animal els04144   Endocytosis els04145   Phagosome els04148   Efferocytosis els05132   Salmonella infection Brite KEGG Orthology (KO) [BR:els00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105017191    04145 Phagosome     105017191    04140 Autophagy - animal     105017191    04137 Mitophagy - animal     105017191    04148 Efferocytosis     105017191  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105017191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:els04131]     105017191   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:els04147]     105017191    04031 GTP-binding proteins [BR:els04031]     105017191 Membrane trafficking [BR:els04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105017191 Exosome [BR:els04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105017191   Exosomal proteins of other body fluids (saliva and urine)    105017191   Exosomal proteins of colorectal cancer cells    105017191   Exosomal proteins of bladder cancer cells    105017191 GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105017191 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_24 AAA_7 NTPase_1 AAA_5 G-alpha ATPase_2 TniB NACHT ATP-synt_ab Motif Other DBs NCBI-GeneID:  105017191 NCBI-ProteinID:  XP_010879895 UniProt:  A0A3P8YK75 LinkDB All DBs Position LG17:complement(20542002..20558652) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagtgctcctgaaagtgatcatccttggggattccggagttggg aagacctccctgatgaatcagtatgtgaacaggaagtttagtaaccagtacaaagccacc atcggcgctgacttcctgaccaaggaggtgatggtggatgatcggctcgtcacaatgcag atctgggacacagcgggccaggagaggttccagtctctgggcgtggccttctatcgtggg gctgactgctgtgtgctggtgtttgacgtgaccgccccaaacaccttcaagaccctagac agctggagggacgagttcctcatccaggccagcccccgagaccccgagaacttccccttt gtggtgctaggcaacaagattgaccttgagaacagacaggtgacaaccaagcgtgctcag gcatggtgccagagtaagaacaacatcccctactttgagaccagtgcaaaggaggccatc aacgtagagcaggctttccagactattgcacgcaatgccctcaagcaggagaccgaggtg gagctgtataatgaattcccggaacccatcaagctggacaggaacgacagagccaaacct tcagcagaggcctgcagctgctga

DBGET integrated database retrieval system