Esox lucius (northern pike): 105017211 Help Entry 105017211         CDS       T04894                                  Symbol rhebl1 Name (RefSeq) GTPase RhebL1   KO K07208   Ras homolog enriched in brain Organism els  Esox lucius (northern pike) Pathway els04140   Autophagy - animal els04150   mTOR signaling pathway els04218   Cellular senescence els04910   Insulin signaling pathway els05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     105017211 (rhebl1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105017211 (rhebl1)   09143 Cell growth and death    04218 Cellular senescence     105017211 (rhebl1)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105017211 (rhebl1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105017211 (rhebl1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:els04031]     105017211 (rhebl1) GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105017211 (rhebl1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf GTP_EFTU RsgA_GTPase SRPRB RhoGAP_pG1_pG2 AAA_14 Motif Other DBs NCBI-GeneID:  105017211 NCBI-ProteinID:  XP_010879926 UniProt:  A0A3P9A650 LinkDB All DBs Position LG17:21016490..21022991 Genome browser AA seq 184 aa AA seqDB search MPQSKYRKIAVIGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFNKMVSVNGQDFNLQLVD TAGQDEYSIFPQSHSMDIHGYVLVYAVTSMKSFEVVQVLHDKLLDMVGKIQVPTVLVGNK KDLHMERVIKPEEGKKLADSWGAAFMESSAKENETAVEVFKQIILEMERADGNVPSEDKK CAVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcctcaatcaaaatacaggaagattgctgtgattgggtacagatctgtaggaaagtct tctctcacgatacagttcgtggaaggacagtttgtagattcctatgaccctaccattgaa aacaccttcaacaaaatggtgtctgtcaatggtcaagatttcaatcttcaattggtcgat actgctggtcaggacgagtattctatttttcctcagtctcattcaatggacatacatggt tatgtcttggtctatgcagtaacctccatgaaaagttttgaagttgttcaggttcttcat gacaagctgctagatatggttgggaaaatacaggtgccaactgttcttgttgggaacaaa aaagatctccacatggaaagggtgatcaagccagaggaagggaagaagctggctgactca tggggagcagcattcatggagtcttctgccaaggagaatgagaccgcggtagaggtgttc aagcagatcatcttggagatggagagggcggatgggaacgttccctcagaggataaaaag tgtgcagtgatgtaa

DBGET integrated database retrieval system