Esox lucius (northern pike): 105030778 Help Entry 105030778         CDS       T04894                                  Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism els  Esox lucius (northern pike) Pathway els04140   Autophagy - animal els04150   mTOR signaling pathway els04218   Cellular senescence els04910   Insulin signaling pathway els05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:els00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     105030778  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105030778   09143 Cell growth and death    04218 Cellular senescence     105030778  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105030778  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105030778  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:els04031]     105030778 GTP-binding proteins [BR:els04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105030778 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase ATP-synt_ab AAA_14 RhoGAP_pG1_pG2 ParE_toxin Motif Other DBs NCBI-GeneID:  105030778 NCBI-ProteinID:  XP_012987799 UniProt:  A0A3P8XQC1 LinkDB All DBs Position LG03:3588917..3598207 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITIDGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKAQVPIMLVGNK NDLHMERVISCEEGKTLAESWRAAFMESSAKENQTAVEVFKRMIQEAEKLEGGVQSGKTS CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagcccaaatcacgaaaaatcgccatcctcgggtacagatccgtaggaaagtcc tcactaactattcagtttgtggaaggccagtttgtcgactcctatgacccaacaatagaa aacacatttaccaagatgatcacgatagatggtcaagaatatcatctgcagctggtagac acagctggccaggatgaatactccatctttcctcagacatactccatagacatcaatggt tacattctggtctactccgtcacgtctaataagagttttgaagtagttcaggttatccat gaaaaactgctggatatggtggggaaagctcaagtacctattatgttggtgggaaataag aacgatctgcacatggaacgggtgatcagctgtgaggagggaaagacactagcagaatcg tggcgggctgccttcatggaatcctcagctaaagagaaccagacagcagtggaggtgttc aagagaatgatccaggaggcggagaagctggaaggcggcgtccaatcagggaagacttcc tgctccttgatgtag

DBGET integrated database retrieval system