KEGG   Elizabethkingia anophelis FMS-007: M876_07065Help
Entry
M876_07065        CDS       T03946                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
emn  Elizabethkingia anophelis FMS-007
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:emn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M876_07065
  Energy metabolism
   00680 Methane metabolism
    M876_07065
Enzymes [BR:emn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M876_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1503068..1505605
Genome map
AA seq 845 aa AA seqDB search
MKTNEQVEKFRQIVKNKFQIYNSLFMSLPYDKMTNIGMLLPFLHEESKEGYENGKSPMEV
MKHFFDSHTDLKTEEERIDLLFRIIQYVERQVVLFDSIEDSAFSTLNANTDPGTVRNLYE
VASQQGKLHIIKEKMEHFGVKVVFTAHPTQFYSNSVQSILHDLNQAIKSDSVTNIDMLLQ
QLGMTSFINQEKPTPYDEAQSIIYYLRYVYYDTLGELYRDTKRVFDDAHINPHLFQLGFW
PGGDRDGNPFVTSEITQRVSSELRLAILKCYYEHLKKLRKRITFPRVTEMLRLISERVYQ
NIFENKYDLTVGEFKKALQDIRHEVKENNNGLFIDKIDDLLGRIDLFGIYFASLDIRQNS
KIHYKALEQIFEKEFGKDYHALGDDEKLNLLLNTSLHVNPEDYSDDIVQDTLKNIYQVKE
IQKINGEKSIHRYIISDSSSIYDVLNVYALFKYCGYQGEDIKIDIVPLFETIEGFENAEA
TMKKLYNLSQYKEHLTRRSDRQFIMLGFSDGTKDAGYIKANWDIYTTKEVLTKVSDENDI
KVIFFDGRGGPPARGGGKTHQFYASQGKSIANHQIELTIQGQTITSVFGTKDQATFNFEQ
LLTAGIENEIFPQDKINLKDWERDLLNELAGISYQKYKALKDHPLFVPYLEEVSTLKYYG
RTNIGSRPSKRNDGQLVFEDLRAIPFVGSWSLLKQNVPGYFGVGTALQRLKAEGRLEDLK
KLYRESMFFKTLIQNSMMSMSKTYFPLTYYLRNDKIFGEFWQILHNEYLLTHEMLLEIAN
YKSLMEEEPLSKSSIKMRENIVLPLLTIQQYALQKIKEENPHKETYEKIVTRALFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaatgaacaagtagaaaaattcagacaaattgtaaaaaacaaatttcagatc
tataatagccttttcatgagccttccgtatgataaaatgaccaacatcggaatgcttttg
ccttttctccatgaggaaagtaaagaaggctatgaaaatggaaaatctccaatggaggta
atgaaacatttcttcgacagccatacagatttgaaaactgaagaagaaagaatagatctt
ctgtttcgtataattcagtatgtagaaagacaggtagtattattcgatagtattgaagat
tctgcattttccacattaaatgctaatacagatccaggaacagttcgtaatttgtacgaa
gtggcatctcaacagggaaagctgcatattattaaagaaaaaatggaacattttggtgtt
aaggttgttttcacagcacacccgacacaattttattccaattcagtgcaatccattctc
catgatctgaatcaggctataaagtccgattcagtgaccaatatagatatgctgttgcaa
cagttggggatgacttcattcatcaatcaggaaaagccaacgccttatgatgaagcccaa
agtattatctattatctgcgctatgtttattacgatactttaggagagctctatcgggat
accaaacgtgtttttgatgatgcacatataaatccgcatttgtttcagttaggcttttgg
ccgggaggcgatagagatggaaatccctttgtgacatcagaaattactcagcgggtatca
tcagaattaagacttgctattcttaaatgttattatgaacatctaaagaaactccgcaag
agaattactttcccaagagttacagaaatgctgagactaattagtgaaagggtgtaccaa
aatattttcgaaaacaaatatgatcttactgtcggagaatttaagaaagctttacaggat
ataagacatgaggtaaaagaaaataataatggtttattcattgataaaattgatgattta
ttaggacgcatagacctgttcggaatttactttgcttcacttgatattcgccaaaacagt
aaaatccattacaaagccttagagcagatttttgaaaaagaatttggcaaagattatcat
gctttgggtgatgatgaaaaactgaatttacttctgaatacatcattacatgttaatccg
gaagattatagtgatgatatagtacaggacactctgaaaaatatctatcaggtaaaagaa
attcaaaagataaacggagaaaaaagtatacaccgttatatcatttcagacagttcttct
atttatgatgttctgaatgtttatgcattatttaaatattgtggttatcagggtgaggat
ataaaaattgatattgtgccattgttcgaaaccatagaaggctttgagaatgcagaagca
acaatgaaaaaactttataatctctctcagtataaagaacatcttacccgccgtagtgat
cgtcagtttattatgctggggttctctgacggaactaaagatgccggttatattaaagca
aactgggatatttatacaaccaaggaagtacttacaaaagtttcggatgaaaatgatatt
aaagttatattctttgatggtagaggcgggccgccggcaagaggaggcggaaaaactcac
cagttttatgcttcacaaggaaaaagtattgcgaatcatcagattgaattaacaattcag
gggcaaacaattaccagtgtcttcgggacaaaggatcaggcaactttcaacttcgagcaa
ttattaacagcaggtattgaaaatgaaattttccctcaggataagattaatcttaaagac
tgggaaagagatttgctaaatgagcttgccggaattagttatcagaaatataaagcactg
aaagatcatccgctttttgtaccatatctggaagaagtcagtacactaaaatattatggg
cgtaccaatatcggaagtcgtccgagtaaaaggaatgatggtcaactggtattcgaagat
ctaagagctattccgtttgtgggatcatggagtttgttaaagcaaaatgtgcctggatac
ttcggcgtgggtacggctttacaaagattaaaagcagaaggaagactggaagatcttaaa
aagctatacagagagtctatgttctttaagacacttattcagaatagtatgatgtctatg
agtaaaacttatttcccgttgacttactatttgcgtaatgataaaatatttggtgaattt
tggcagatcctgcataatgaatacctgctgacccatgaaatgcttttggaaatagccaat
tacaaatctctgatggaggaagaaccattgtctaaaagttccatcaaaatgagagagaac
attgtactaccattactaaccattcagcaatatgctttacaaaagattaaagaagagaat
ccgcataaagaaacctatgaaaagattgttacaagagcattatttggaaatattaatgcc
agtcgtaattcggcataa

DBGET integrated database retrieval system