KEGG   Enterobacter sp. R4-368: H650_04060Help
Entry
H650_04060        CDS       T02700                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
enr  Enterobacter sp. R4-368
Brite
Enzymes [BR:enr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H650_04060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGN84402
UniProt: R9VHU3
LinkDB All DBs
Position
728089..728670
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGSAFEGKSLEEIVKSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGELAAAIAKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAGTPLTSDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWSFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccgtatgcaaaagacgccctggcgccgcatatctca
gccgaaacgctggaataccactatggtaaacaccatcagacgtatgtcaccaacctcaac
aacctgatcaaaggcagcgcttttgaaggtaaatcgctggaagagattgtgaaaagcagc
gaaggcggcgtgttcaataatgcagcccaggtctggaatcatactttctactggaactgc
ctggccccgaatgctggcggtgaaccgaccggtgagctggcggcagctatcgccaaatca
ttcggcagctttgccgaattcaaagcgcaattcaccgatgctgcggttaaaaacttcggt
gctggctggacgtggctggtgaaaaaagcggatggcacattagccattgtttcaacgtct
aatgcgggcactccgctgacaagcgatgcaaccccgctgttaaccgtcgatgtctgggaa
catgcgtattacatcgattaccgtaatgcgcgtccgaactacctcgaacatttctgggcg
ctggtaaactggtcattcgtggccaaaaatttagcggcataa

DBGET integrated database retrieval system