KEGG   Enterobacter sp. 638: Ent638_0257Help
Entry
Ent638_0257       CDS       T00507                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ent  Enterobacter sp. 638
Pathway
ent00473  D-Alanine metabolism
ent01100  Metabolic pathways
ent01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ent638_0257
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Ent638_0257
Enzymes [BR:ent01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Ent638_0257
Peptidoglycan biosynthesis and degradation proteins [BR:ent01011]
 Precursor biosynthesis
  Racemase
   Ent638_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABP58946
UniProt: A4W5G6
LinkDB All DBs
Position
302166..303245
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFEATDLTTIADQHLHTAIHNEEQLLALETAELSEPVTVW
MKLDTGMHRLGVRPEQAEAFYQRLSQCKNVHQPVNIVSHFARADEPECGATEQQLDIFNT
FCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVSPLENKPWGPDFGLQPVMSLVSN
LIAVREHKAGEPVGYGGTWVSESDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVKIVGR
VAMDMICVDLGPDAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgtagtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcccgccagtaaactcgttgcagtcgtgaaagcgaacgcttacggacac
ggtcttcttgagaccgcgcgaacgctccctgatgccgatgcctttggcgtcgcccgtctc
gaagaagccctacgtttacgcgcgggcggtattacgcaacccattctgttgttagaaggt
ttctttgaagcgactgacctgacgacgatcgccgatcagcatctgcacacagcgattcac
aatgaagaacagctgctggcgttggaaacggctgaactgagcgaaccggtcaccgtgtgg
atgaagcttgatactggcatgcatcgcctgggcgtgcgtccggaacaggccgaggcgttt
tatcagcgcttaagccagtgcaaaaacgtgcaccagccggtgaatatcgtcagccatttt
gcccgcgccgacgaaccggaatgtggcgcaacggagcagcagctcgatatttttaatacc
ttttgcgaaggcaagccaggcatgcgttctatcgccgcttctggcggcattttgctgtgg
ccgcaatcgcactttgactgggcgcggcctggcatcattctttacggcgtttcaccgctg
gaaaacaaaccctggggccctgattttggtctgcagccggtaatgtctttggtgtcgaac
ctgatcgctgtgcgcgagcacaaagcgggtgaacctgttggctatggcggcacgtgggtg
agcgagagcgatacgcgcctgggcgttgtggcgatgggttatggcgacggttatccacgc
gcggcaccttcgggaacgccagtgctggtgaatggccgtgaggtgaagattgtcggccgt
gtcgcgatggacatgatttgcgtcgatctggggccagacgctcaggataaagcgggtgat
gccgttgtgctgtggggcgaaggtttgcctgttgagcggattgctgaaatcacgaaagtg
agtgcttacgaacttatcacgcgtctgacgtctcgcgtggcgatgaaatacatcgactaa

DBGET integrated database retrieval system