KEGG   Enterobacter sp. 638: Ent638_3864Help
Entry
Ent638_3864       CDS       T00507                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ent  Enterobacter sp. 638
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ent00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ent638_3864
   00650 Butanoate metabolism
    Ent638_3864
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ent638_3864
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ent638_3864
Enzymes [BR:ent01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ent638_3864
Amino acid related enzymes [BR:ent01007]
 Aminotransferase (transaminase)
  Class III
   Ent638_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4174618..4175883)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGVGVMCGFYADKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAIENQLQSFTHTAYQIVPYESYIALAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAQYPNMLHGVSSQ
EALKSVERIFKADIAPDQVAAIILEPVQGEGGFNVAPADFMQGLRALCDTHGILLIADEV
QTGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRADVMDAPAPGGLGGTYAGN
PLAIVAALAVLDVIDEDDLCTRAAHLGHHLVEVLNKAKSDCPFIADIRAQGSMVAVEFND
PETGQPSPEFTREVQDRALQEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaattgaatgaacggcgtttacaggccacgccacgtggagtcggcgtc
atgtgtgggttctacgccgacaaagccgaaaatgcgaccctgtgggatgtggaaggcaac
gaagtgatcgacttcgcggcgggtatcgcggtgctcaataccggtcatcgccatcccaaa
gtgatcgccgccattgaaaaccagctgcaatccttcacccatacggcctatcagatcgtg
ccttacgagagttacatcgccttagcggaacgtatcaacgcccgcgtgccgatcgacggg
ccagcaaaaacggcgttcttctcgacgggcgctgaagcggtggaaaacgccgtcaaaatc
gcgcgggcttacaccaaacgccccggactgatcacctttggcggtgcgttccatggccgt
acctttatgaccatggcgctcacgggcaaagtggccccgtacaaaattggctttggcccg
ttccccggctcggtttaccacgcgcaataccccaacatgctgcacggcgttagctcgcaa
gaggcgttgaaaagcgttgagcgtatcttcaaagcggatatcgcacccgatcaggtggcc
gctatcattcttgaaccggttcagggtgaaggtgggtttaacgttgcgccggccgatttc
atgcaagggctgcgtgcgctatgcgatacccatggcattttgctgatcgcagatgaggtg
caaaccggctttgcccgtaccggcaaactgttctcgatggaacaccactgcgtgaagcct
gatttaattaccatggcgaaaagtctggcgggcggaatgccgctgtcggcagtgtcgggt
cgcgccgatgtgatggacgcccctgcgcctggtggtctgggcgggacttacgccggtaac
ccgctggcgatcgtcgccgcgctggcggtgctggacgtcatcgacgaagacgatctctgc
acccgcgcggcgcatctgggccatcatctggtggaagtgctgaacaaagccaaatctgat
tgcccgtttatcgccgatattcgcgcccaagggtcgatggtggcggtggaattcaatgac
ccggaaaccggacagccgtccccagaatttacccgcgaggtgcaggaccgcgcgttgcag
gaaggtctgctgctgctgagctgcggcgtgtacggcaacgtgattcgcttcctctatccg
ctcaccattcctgaagcacagttccgcaaagcgctggatattatctctgcctcgctgaca
cgttaa

DBGET integrated database retrieval system