KEGG   Enterobacter sp. E20: NI40_001265Help
Entry
NI40_001265       CDS       T04118                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
enx  Enterobacter sp. E20
Pathway
enx00250  Alanine, aspartate and glutamate metabolism
enx00410  beta-Alanine metabolism
enx00640  Propanoate metabolism
enx00650  Butanoate metabolism
enx01100  Metabolic pathways
enx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NI40_001265
   00650 Butanoate metabolism
    NI40_001265
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NI40_001265
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NI40_001265
Enzymes [BR:enx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NI40_001265
Amino acid related enzymes [BR:enx01007]
 Aminotransferase (transaminase)
  Class III
   NI40_001265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALL15836
LinkDB All DBs
Position
284245..285510
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VISAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPVDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNELHGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQTGQPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggcatcggcgtg
atgtgtaacttctacgccgataaagctgaaaacgccacggtgtgggacgtggaaggtaac
gagtatatcgacttcgccgccgggatcgcggtgctgaataccggccatcgccatccaaaa
gtcatttccgccattgaaaaacagctccacgcgtttacccatacggcgtaccagattgtg
ccgtacgaaggctatgtggcgcttgccgagcgcatcaaccagcgcgtgcccgttgacggt
ccggccaaaaccgcgttcttctccacgggggcagaggcggtcgaaaacgcggtcaaaatt
gcccgggcgtataccaaacgtcccggccttatcaccttcggcggcgcgttccacggccgc
acctttatgaccatggcgctgaccggcaaagttgcgccgtacaagctcggctttggcccg
ttccccggttcggtgtatcacgcgcagtatccgaatgaactgcacggcgtcagcacggcg
gaagcgttgaaaagcctggaacgcatctttaaagcggatatcgcacccgaccaggtcgcg
gccattattctcgaaccggttcagggagagggcggtttcaacattgcgccagctgatttt
atgcaggcgctgcgcgccctgtgcgacacccacggtattttgctgattgccgacgaggtg
caaagcggcttcgcccgtaccggcaagctgttctcgatggaacaccactgcgtgaagccc
gatctgatcaccatggcgaaaagcctggcgggcgggatgccgctctcagcggtttctggc
cgtgcggaggtgatggatgcccctgcaccgggcgggctgggcggtacctacgccggaaac
ccgctggcgattgcggcggcgcatgccgtgctcgacgtgattgatgaagaggatctctgc
acgcgctcggcgcatcttggccatcacctggtggaagtgctgaacaaggcgaaagaacac
tgcccgtatatcgctgacattcgcgcgcagggatcgatggtggcggtggaatttaacgac
ccgcaaacgggccagccttcgccggaatttacccgccaggtgcaggagcgtgcgttgcag
gaagggctgcttcttctgagctgcggcgtctacggcaacgtcattcgtttcctgtatccg
ctgactatccctgaagcgcagttccgtaaagcgctggacattatctccgcgtcgctgaca
cgttaa

DBGET integrated database retrieval system