KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4619Help
Entry
ECO103_4619       CDS       T01096                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase SodA
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
Enzymes [BR:eoh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECO103_4619 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(4747982..4748602)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcagacctacgtaaacaacgccaac
gcggcgctggaaagcctgccagaatttgccaacctgccggttgaagagctgatcaccaaa
ctggaccagctgccagcagacaagaaaaccgtactgcgcaacaacgctggcggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgaaaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgctgaaaggcgataaactggcg
gtggtttctactgctaaccaggattctccgctgatgggtgaagctatttctggcgcttcc
ggcttcccgattctgggcctggatgtgtgggaacatgcttactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagctgcggcg
cgtttcgcggcgaaaaaataa

DBGET integrated database retrieval system