KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00164Help
Entry
EPYR_00164        CDS       T02121                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPCase) (PEPC)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EPYR_00164 (ppc)
  Energy metabolism
   00680 Methane metabolism
    EPYR_00164 (ppc)
Enzymes [BR:epr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EPYR_00164 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(172491..175142)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGHDAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHTISPNGEGAKNPELLAKTFQRLKQQPALTEA
AVHEALGSLSLELVLTAHPTEITRRTLIHKLVEVNSCLKQLDHNDLSDYEHAQIMRRLRQ
LVAQAWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPQFLRELNEQVEAAFGYTLPVDF
VPVQFTSWMGGDRDGNPNVTADITRHVMQLSRWKATDLFLRDIAVLISELSMSECTPEVR
ELCGNPEALEPYREIMKNLRSQLMSTQAYLAGRLKGERLARPADLLISNEQLWNPLYTCY
QSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDIRQESTRHTEAIAEITRYLGLGDFES
WSEADKQAFLIRELNSKRPLTPRQWEPSAETKEVLDTCRVAAEAPQGSIAAYVISMAKTP
SDVLTVHLLLKEAGIGYAMPVAPLFETLDDLNNANAVMSQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTGAILEANLLPPPEPKTEWIGIMDRL
STVSCQMYRGYVREHADFVPYFRSATPEQELAKLPLGSRPAKRRPAGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQQAMADGHQDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVDKSLWPLGKQLRDRLESDIKAVLTIANDAHLMADQPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEAAGGEPDARVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtatgctcggcaaactgctcggg
gatacgattaaagatgcactgggagagaacatcctcgaccgggtagaaactattcgtaaa
ctctctaagtcatctcgtgcgggtcatgacgcccaccgtcaggaactgctttccacgctg
caaaacctgtctaacgacgagctgctgccggttgcacgcgctttcagccagttcctgaac
ctcaccaacgttgccgagcagtaccacaccatttcgccgaacggcgaaggtgctaagaat
ccggaactgctggcgaaaacgtttcagcgcctgaagcagcagccggccctcaccgaagct
gccgtccatgaagcccttggttccctgtcgctggaactggtactgaccgcgcatccgact
gaaatcacacgccgcaccctgatccacaaactggtggaagtgaacagctgtctcaagcag
ttagatcacaatgatttatctgactatgagcacgcacagatcatgcgccgcctgcgccag
ctggtcgcgcaagcatggcataccgacgaaatccgtaaatatcgtccgtccccggttgac
gaagccaagtggggttttgcggtggtggaaaacagcctgtgggaaggtgtgcctcagttc
ctgcgtgagctgaacgagcaggtagaagccgcttttggttataccctgccagtcgacttt
gttccggtgcagtttacctcatggatgggaggcgaccgtgacggcaacccgaacgtcacc
gccgatatcactcgccacgtcatgcaactcagccgctggaaagccaccgacctgttcctg
cgcgacatcgccgtactgatttccgagctgtcgatgtccgaatgtacgccggaagtgcgc
gagctgtgcggcaacccggaagcgctggagccgtaccgcgagattatgaaaaacctgcgc
agccagctgatgagcacccaggcttacctggctggccgcctgaaaggcgaacgtttagcg
cgccctgccgacctgctgatttcgaacgaacagctgtggaacccactgtatacctgctac
cagtcattacaggcctgcggtatgggcattattgctaacggccagctactggataccctg
cgccgcgtgaagtgttttggcgtgccgctggtacgcatcgatatccgtcaggaaagcacc
cgccacacggaggcgattgctgaaatcacccgttatcttggtctgggcgattttgagagc
tggtcagaagccgacaagcaggcgttcctgatccgcgaactgaattccaaacgcccgctg
acgccgcgtcagtgggagccgagcgccgaaaccaaagaggtgctggatacctgtcgcgtg
gccgctgaagcgccccagggatcgattgccgcctatgttatctcaatggcgaaaacaccg
tctgacgtgctgacggtgcatctgctgttgaaagaagccgggattggctatgccatgccg
gtggctccgctgtttgaaaccctcgacgacctgaataatgccaacgcggtgatgagccag
ctgctgaatatcgactggtatcgcggtctgattcagggcaagcagatggtgatgattggt
tactccgactcggcaaaagatgccggtgtaatggcggccagctgggcgcagtatcaggca
caggatgcgctgatcaaaacctgtgagaaggccggaattaccctgacgctgttccacgga
cgcggcggtagcattgggcgcggtggcgctccggcacatgcggcgctgctgtcccagccg
ccgggcagcctgaaaggtgggctgcgcgtcaccgaacagggtgagatgatccgctttaag
tacggcctgccggaagtgaccatcagcagcctgtcgctgtacaccggggcgatcctcgaa
gccaacctgttgccgccgccggagccaaagaccgagtggatcggcattatggatcggctg
tcgacggtctcctgtcaaatgtaccgtggctacgtgcgtgaacacgcggactttgtgccg
tacttccgttctgccacgccagagcaggagctggctaaactgccgctcggctcccgtccg
gcgaaacggcgtccagccggcggcgtcgagtcgctacgtgccattccttggatcttcgcc
tggacgcagaaccgcctgatgctgcccgcctggctcggtgccggggctgcgctccagcag
gcgatggcagacggccatcaggaccagctggaagccatgtgccgcgactggccattcttc
tctacgcgcctggggatgctggaaatggtgttctcgaaggccgacctgtggctggcggaa
tattacgatcagcgcctggtcgataaatcactgtggccgctgggcaaacagctgcgcgat
cggctggagtccgatatcaaagcggtgctgaccattgccaacgatgcgcatctgatggcc
gaccagccgtggattgccgagtcgattgcgctgcgtaatgtctataccgatccgcttaac
gtcttgcaggccgaactgctgcaccgttcacgccagcaggaagcagcgggcggtgagccg
gatgcccgcgtcgagcaggcgctgatggtgaccattgctggcgtcgcggcggggatgcgt
aataccggttaa

DBGET integrated database retrieval system