KEGG   Equus przewalskii (Przewalski's horse): 103558454Help
Entry
103558454         CDS       T04644                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04068  FoxO signaling pathway
epz04146  Peroxisome
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:epz00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    103558454 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103558454 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    103558454 (SOD2)
   04213 Longevity regulating pathway - multiple species
    103558454 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    103558454 (SOD2)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103558454 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103558454
NCBI-ProteinID: XP_008529694
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGSLGSRQKHSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLDA
IKRDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacgagcaggaagctggtgccagctctggggtctctg
gggtcccggcagaagcacagcctccccgacttgcagtatgattatggcgctctggagccc
tacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctatgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgctggccaagggggacgtgacagct
cagattgctctgcagcctgcactcaagttcaatggtggaggccatatcaatcataccatt
ttctggacaaacctgagccccaatggcgggggagaacccaaaggggaattgctggacgcc
atcaaacgtgactttggttccttcgacaaatttaaagagaagttgactgctgtatcggct
ggtgtccaaggctcgggttggggttggcttggtttcaataaggaccagggacgcctccag
attgttgcctgtcctaaccaggatcccctgcagggaacaacaggtcttattcccctgctg
gggattgacgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattat
ctgaaagccatttggaatgtgatcaactgggagaatgtatctgagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system