KEGG   Equus przewalskii (Przewalski's horse): 103560351Help
Entry
103560351         CDS       T04644                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00511  Other glycan degradation
epz00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:epz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103560351 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103560351 (NEU4)
Enzymes [BR:epz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     103560351 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR Transglut_core3
Motif
Other DBs
NCBI-GeneID: 103560351
NCBI-ProteinID: XP_008532657
LinkDB All DBs
Position
Un
AA seq 467 aa AA seqDB search
MGVPARTVLFQRERTGLTYRVPALLSVPPGPILLAFAEQRLSPDDAHAHRLVQRTGRLAG
GSVRWDAARVLGTAALEEHRSMNPCPVHDARTATVFLFFIAVRGHTGLPSILPTPQGGAA
RPWLWLWLSPSWGNQQPLLSADWATFAVGPGHGIQLRSGRLLVPAYTYRVDRRECFGKIC
RTSPHSFAFYSDDHGRTWHHGGVVPNLRSGECQLAVVDGEQASGILYCNARSPLGSRVQA
LSTDEGTSFLPGELVPTLAETARGCQGSIVGFPAPPFSQPWDEGWSVGARNPPHPPRLSP
GVQELLEEGAGDTPGGEGLGGTEGCGDSPGEPGPGPGLSGNRGALKLPGPPATLSQSPTW
LLYSHPVGRRARLHMGIRLSRSPLDPHSWTEPWVIYEGPSGYSDLASIGPTPQGAPAFAC
LYESGARVSYEEISFCMFSLPEVLENVLAIPEPPSPGGKPRGHCRPS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgccggcgcggaccgtgctcttccagagagagaggaccggcctgacgtaccgt
gtgcccgcgctgctgtccgtgccccccgggcccatcctgctggccttcgcggagcagcgg
ctcagccccgacgacgcgcacgcccaccgcctggtgcagaggactggccggctggccggg
ggctccgtgcggtgggacgccgcgcgcgtgctggggacagcggccctggaggagcaccgc
tccatgaacccgtgcccggtgcatgacgcgcgcacggccactgtcttccttttcttcatc
gccgtgcgcggccacactggcctgccatccatcctgcccaccccccagggtggcgctgcc
cggccctggctgtggctgtggctgtctccctcctggggtaaccagcagcccctcctctcc
gcagactgggccaccttcgctgttggcccgggacatggcatccagctgcgctcaggccgc
ctgctggtgccggcctacacctaccgtgtggaccggcgagagtgctttggcaagatctgc
aggaccagcccccactcctttgccttctacagcgatgaccatggccgcacctggcaccac
ggaggcgtcgtgcccaacctgcgctcgggcgagtgccagttggctgtggtagacggggag
caggccagcggcatcctctactgtaatgcccggagccccctgggcagccgtgtgcaggcg
ctcagtacagatgagggcacctccttcctgcccggggagctggtgcccaccctggctgag
accgcccggggctgccagggcagcattgtgggcttcccggccccgccctttagccagccc
tgggatgagggatggtcagtgggtgccaggaaccccccccaccctccacgcctcagtcct
ggagtccaggaactcctagaggagggcgctggagacaccccagggggcgagggactgggt
gggacagagggatgtggggacagccctggggagcctggcccagggcctgggctcagtggg
aacaggggggccttgaagctccctgggccccctgccactttgtctcagagccccacatgg
ctgctgtactcccacccggtggggcgcagggctcggcttcatatgggcatccgcctgagc
cggtcccccctggacccccacagctggacggagccttgggtgatctatgagggccccagt
ggctactctgacctggcgtccattgggcccaccccccagggagccccggccttcgcctgt
ctgtatgaaagtggggccagggtctcctatgaggagatctccttctgcatgttctccctg
cccgaggtcctggagaacgtgctggccatccccgagccgcccagccctgggggcaaacct
cgggggcactgccggccctcctga

DBGET integrated database retrieval system