KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0299Help
Entry
ERH_0299          CDS       T01525                                 

Gene name
nanH.1
Definition
(GenBank) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:erh00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ERH_0299 (nanH.1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ERH_0299 (nanH.1)
Enzymes [BR:erh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     ERH_0299 (nanH.1)
Bacterial toxins [BR:erh02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   ERH_0299 (nanH.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(331513..335109)
Genome map
AA seq 1198 aa AA seqDB search
MKKISNIFVVLLTLVLGISLYPSSIFAMNDLNLNDLHLKGEGADISDHLSHIKEFNQGSL
TLRFRSESLSSDLTALFSISNANLENNYFALYYQNSTGKLGIEFRDETGKHIINTSGTST
QLANANWHTVTVLNHGNRVEIYADGILLASQDNIDFTKIQSLPWNRMKVGGVARLKGENL
WPFSGKISSLNLTHDILDVDTIKTLHNDTASTVDPSTSEAIELYAPGQDGSKNYRIPSLL
TTQDGTVLAAIDKRITHQADWGNIDIAIRRSQDSGKTWSDTEVIIDLKSDPNVSQENVNT
NYQSSAFLIDAAMAQDNRNGRIYLLVDMFPESRGFFSVQNEDQDFGQPYVTKEDGTHIVL
KGTDGKKYYAKADGTVFDLNTDIITNYRVVLESEKGMPFNDLGDLYEGDTYVGNIYLKKS
PLRIRQTAYLWLTHSDDDGQTWSSPHDITPQVKADWMQFIGTGPGVGIQLKNGELAFPIY
HTNRHGGNSQSTSMIKSADGITWHKTESLNDNRNFNGQVLNSKTLNNGGALVTESQVVQL
NNGTLKQFARNVSGKVLVGTSYDNGETWENDLETLPITDVYSQMSALHYNHEGKEYILLA
NPNGPKRTNGAVKLLQVLEGERLVLLSNTHMQSGNYEYNVVQPLPDGHFGLMYEHKKPEN
GDNMSMMFKRFSFEDLGVKDTSSLSLDIQDTYLEIKSDKALIPSSNLTLTYNTTQTTKPK
RVDTNTLRFNLAEPVTILNGFTEGYLETLDGKALNIANKQGLDESLETLKALDFENLAPS
VKDAADQLITKAELLSDNPFTIGDFIQQIHAMIGAIDPTYIPNSMFDVTASSQEDEKGNT
QVEGPIGLAFDGDPSTFWHSKWGDKNPPFDVTVSFHHDMVVNALTYLPRQDGTLNGVVTE
YQILGKLGDAPLHVLNEGTLDTNLTKKIITFEDAHVDTLIFKVVKGLENYGNAAEITLHG
KTYRAPLDYSSLNQVLKTLENYNQSLYTEASFKPLLELKEKAYELLDNSETTQEMIDEMV
INLNEFINNLELSNYTLDSLRLKIQEVEDYMNTLDLALYTQTSVQAVYDALDSAKALLQT
PRFSFRSLFKASTPNEAQIKEAIESLDSAVRGLSKREVETEEPSNPDENITPPIVDPKPD
TDSQKPETPDSNTEDSAQISPTDKTDVTLPKTGQAVSGFIGLGMLVSLCGFVIFKRKQ
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaataagtaacattttcgtcgtgcttcttacacttgtattgggtattagtctt
tacccaagttctatctttgctatgaatgatctaaatcttaatgacctacacttaaaggga
gaaggtgctgatatttccgaccatttatcacacatcaaagaatttaaccaaggttcccta
accttacgtttccgttctgaatcactatccagtgatcttactgcactgttttcaatatca
aacgcaaatttggaaaacaactatttcgcgctttactatcaaaacagtaccggtaagctt
ggcattgaattcagagatgaaaccggcaaacatattatcaatacgtcgggcacaagtacc
cagcttgccaacgcaaactggcacaccgttaccgttttaaatcatggaaatcgtgttgaa
atatatgcagatggaatcttacttgcatcccaagataatattgatttcacgaaaatccaa
tctttaccttggaatcgtatgaaagtcggtggcgttgcacgtttaaaaggtgaaaactta
tggccttttagtgggaaaatttcttccctaaacctaacgcatgacatcctcgatgtcgat
accattaaaacactgcataacgacactgcttcaactgttgatccatcgacttcagaagca
attgagctctatgcaccaggacaagatggcagtaaaaactaccgcattccaagtcttctt
acaacgcaagatgggaccgtcttagctgcgattgataaacgtattacccatcaagcagac
tggggaaatatcgatatcgcaatccgtagaagtcaagacagcggtaaaacatggtctgat
accgaagtgattattgatctaaagtcagatccaaatgtatctcaggaaaatgtaaatacg
aactatcaaagttccgcattcctcattgatgcggcaatggcacaagataaccgtaatgga
cgtatctatcttttagtcgatatgttcccagaatcacgtggattctttagtgtccaaaat
gaagaccaagactttggtcaaccttatgtaaccaaagaagatggtacccatattgttctg
aaaggtactgatggcaaaaaatattacgcaaaagctgatggaaccgtatttgatctaaat
actgatatcatcacgaattaccgtgttgtcttagaatctgagaaaggcatgcctttcaat
gatcttggtgacctttatgaaggtgatacgtatgtgggaaatatctaccttaagaaaagt
cctctacgcattcgtcaaaccgcttatttatggttaacccattcagatgatgacggtcaa
acatggtcatcaccccatgatattacaccacaagtcaaagcggattggatgcagttcatt
ggaacgggtcccggtgttgggattcaacttaaaaatggcgaacttgccttcccgatttac
catactaaccgtcatggtggtaattcacaatctacatcaatgatcaaaagtgccgatggt
attacatggcataaaacggaatcactcaatgacaatcgtaactttaacggtcaagtttta
aattctaaaaccttaaataacggcggtgcattggtaactgaatctcaagtggtccaactt
aataatggaaccctgaaacaatttgcgcgaaatgtatccggaaaagttttggtaggtact
tcttatgataatggagaaacctgggagaatgatcttgaaacacttccaattaccgatgtt
tactcacaaatgtccgccctacattataaccatgaaggtaaagagtatatcttacttgca
aatccaaatggtcctaaacgtaccaatggggctgtgaaactgcttcaagttttagaaggt
gaacgtctcgtacttctttctaatacgcatatgcaaagtggaaattacgagtacaatgtg
gttcaaccacttcctgatggacatttcggcttaatgtatgaacataaaaaacctgaaaac
ggggataatatgtcgatgatgtttaagcgcttctcctttgaagatttaggtgtcaaagat
acctcaagtctaagtcttgatattcaggatacctatcttgaaatcaaatcggataaggct
ttaattcctagttcaaacttaacgttaacgtataatacaactcaaacaacaaaaccgaaa
cgtgttgatacgaacacattacgctttaacttagcagaacccgtcaccattctcaatgga
tttactgaagggtatcttgaaacacttgatggaaaagcactcaatattgcgaataaacaa
ggtcttgatgaatcgcttgaaacacttaaagcccttgattttgaaaacttagcaccaagt
gtgaaggatgcagcggatcaactgattaccaaagcagaactcttaagtgataatcccttt
accatcggtgatttcatccaacaaattcatgcaatgattggtgcgattgatccaacttac
attccaaactcaatgtttgatgtaacggcatcaagtcaagaagatgaaaaagggaataca
caagtagaaggtcccatcggtttagcctttgatggagacccaagtaccttctggcactcc
aaatggggtgataagaacccgccatttgatgtaacggtttcgttccatcatgacatggtt
gtgaatgcgttgacctatctaccacgtcaagacggaacccttaatggtgtcgtcacagaa
tatcaaatcttaggtaaattgggcgatgcaccacttcatgttctcaatgaaggaaccctt
gatacaaaccttacaaagaaaataatcacgtttgaggatgctcatgtggatacactgatc
tttaaagttgtgaaaggtcttgaaaactatggaaatgctgcggaaattaccctgcatgga
aaaacgtatcgtgcacctcttgattattcaagcttaaatcaagtacttaaaacacttgaa
aactacaaccaaagtctttataccgaagcaagttttaaaccattacttgaattaaaagaa
aaagcctatgagcttctcgataactcagaaacaacacaggaaatgattgatgaaatggtt
ataaacctcaatgaattcatcaataatctcgagttaagcaactatactttagattcatta
cgtctgaaaattcaagaggttgaagattatatgaatacacttgatttggctctctacaca
cagacaagtgtacaggctgtttatgatgctcttgattcagcgaaagcactgcttcaaacg
ccacgcttcagttttagaagtctcttcaaagcttctacaccaaacgaagctcagattaaa
gaagccattgaatccttggactcagccgttagaggtttaagcaaacgtgaggttgaaaca
gaggaaccatcaaatcctgatgaaaacatcacacctccaatcgtagatccaaaaccggat
acggattctcaaaaacctgaaactccagatagcaatactgaagacagtgctcaaatttca
cctaccgacaaaaccgatgtaacacttcctaaaacaggacaagctgtttctggatttatc
ggacttggtatgcttgtatccctatgtggttttgtgatttttaaacgaaaacaataa

DBGET integrated database retrieval system