KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3406Help
Entry
ECSF_3406         CDS       T02077                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECSF_3406
Enzymes [BR:ese01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECSF_3406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3693224..3695254
Genome map
AA seq 676 aa AA seqDB search
MKLAACFLTLLPGFAVAASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLTLNFDQQCWQP
ADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQLDTRSGTPTLMISIQNAVEPVASLVRE
CPKWDGLPLTLDVSATFAEGAAVRDYYSQQIAIVKNGQITLQPAATSNGLLLLERAETDT
SAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQ
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGSEADLRTLVDSA
HQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKTLGERWNDWKPAAGQTWHS
FNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTASGLPVF
YKNKTDTHAKIIDGFTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAA
LHEWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQ
MDTTWQQMAEKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTTLSLKQGYGFV
REHGDDKVLVIWAGQQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgccgcctgttttctgacactccttcctggcttcgccgttgccgccagctgg
acttctccggggtttcccgcctttagcgaacaggggacgggaacatttgtcagccacgca
cagttgcccaaaggtacgcgtccactaacgctaaattttgaccaacagtgctggcagcct
gcggatgcgataaaactcaatcagatgctttccctgcaaccttgtagcaacacgccgcct
caatggcgattgttcagggacggcgaatatacgctgcaactagacacccgatccggtaca
ccaacattgatgatttccatccagaacgccgtcgaaccggtagcaagcctggtccgtgaa
tgcccgaaatgggatggattaccgctcacactggatgtcagcgccacttttgcggaggga
gccgcagtccgggattattacagccagcaaattgcgatagtgaagaacggtcaaataacg
ttacaacccgctgccaccagcaacggtttactcctgctggaacgggcagaaactgacaca
tccgcccctttcgactggcataacgccacggtttactttgtgctgacagatcgtttcgaa
aacggcgatcccagtaatgaccagagttacggacgtcataaagacggtatggcggaaatt
ggcacttttcacggcggcgatttacgcggcctgaccaacaaactggattacctccagcaa
ctgggcgtcaatgctttatggataagtgccccatttgagcaaattcacggctgggtcggc
ggcggtacaaaaggtgatttcccgcattatgcctatcatggttattacacacaggactgg
acgaatcttgatgccaatatgggcagtgaagccgatctacggacgctggttgatagcgcg
catcagcgcggtattcgtattctctttgatgtcgtgatgaaccacactggctatgccacg
ctggcggatatgcaggagtatcagtttggcgcgttatatctttctggtgacgaagtgaaa
aaaacgctgggtgaacgctggaacgactggaaacctgccgccgggcaaacctggcatagc
tttaacgattacattaatttcagcgacaaaacaggctgggataaatggtggggaaaaaac
tggatcagaacggatatcggcgattacgacaatcctggattcgacgatctcactatgtcg
ctggcctttttgccggatatcaaaaccgaatcaactaccgcttctggtctgccagtgttc
tataaaaacaaaacggatacccacgctaaaatcatcgacggctttacccctcgcgattac
ttaacccactggttaagtcagtgggtccgcgactatgggattgatggttttcgggtcgat
accgccaaacatgttgagttgcccgcctggcagcaactgaaaaccgaagccagcgctgca
cttcacgaatggaaaaaagctaaccccgacaaagcattagatgacaaacctttctggatg
accggtgaagcctggggccacggcgtgatgcaaagtgactactatcgccacggcttcgat
gcgatgatcaatttcgattatcaggagcaggcggcgaaagctgtcgattgtctggcgcag
atggatacgacctggcagcaaatggcggagaaattgcaggatttcaacgtgttgagctac
ctctcgtcgcatgatacccgcctgttccgtgaagggggcgacaaagcagcagagttatta
ttattagcaccaggcgcggtacaaattttttatggcgatgaatcctcgcgtccgttcggt
cctaccggttctgatccgctgcaaggtacgcgttcggatatgaactggcaggatgttagc
ggtaaatctgccgccagcgtcgcgcactggcagaaaatcagccagttccgcgcccgccat
cccgcaattggcgcgggcaaacaaacgacactttcgctgaagcagggctacggctttgtt
cgtgagcatggcgacgataaagtgctggtcatctgggcggggcaacagtga

DBGET integrated database retrieval system