KEGG   Escherichia coli O104 H4 2011C-3493: O3K_19605Help
Entry
O3K_19605         CDS       T02257                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    O3K_19605 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O3K_19605 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    O3K_19605 (ddl)
Enzymes [BR:esl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     O3K_19605 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:esl01011]
 Precursor biosynthesis
  Amino acid ligase
   O3K_19605 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4017456..4018550
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgctaatcgtcacaacatcagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaatccgcaa
gccagcacctgtggcgagatcgtactcaccagcgatttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcaccagagatcaacgat
aagatccgggcgattgccgttcaggcttatcagacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagagaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctcggttacacc
gatctgatcacacgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system