KEGG   Edwardsiella tarda EIB202: ETAE_3484Help
Entry
ETAE_3484         CDS       T01121                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00620  Pyruvate metabolism
etr00680  Methane metabolism
etr01100  Metabolic pathways
etr01120  Microbial metabolism in diverse environments
etr01200  Carbon metabolism
Module
etr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAE_3484
  Energy metabolism
   00680 Methane metabolism
    ETAE_3484
Enzymes [BR:etr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ETAE_3484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACY86315
UniProt: D0ZHC2
LinkDB All DBs
Position
3678300..3680933
Genome map
AA seq 877 aa AA seqDB search
MNEQYSAMRGNVSMLGKLLGDTIKDALGEDILDRVETIRRLSKSSRAGNEASRQALLNTL
QNLSNDELLPVARAFSQFLNLANVAEQYHRISPHGEAASNPDALSHLFTRLKNKNLDEAQ
IRQAVDNLSIELVLTAHPTEIARRTLIHKLVEVNTCLSQLDHDDLADYERHQIMRRLRQL
VAQSWHTDEIRKNRPTPIDEAKWGYAVVENSLWEGVPAFLREFNEQLEKSLGYQLPVEAV
PVCFTAWMGGDRDGNPNVTAEVTRRALLLSRWKAAELFLRDVQVLVSELSMTVCTPELRA
LAGEHAQEPYREVLKRLRQQLNNTLTYLDARLRGERLPRPTDLLVSNDQLWQPLHTCYRS
LKACGMGIIANGQLLDTLRRVHCFGVPLVRIDIRQESTRHTEALAELTRYLGLGDYETWS
EEDKQTFLLRELNSKRPLVPRHWTPSPETKEVFDTCQVIAEAPAGAIAAYVISMARTPSD
VLAVHLLLKEAGCPYNLPVAPLFETLDDLNNAEAVMTQLLSIDWYRGFIQGKQMVMIGYS
DSAKDAGVMAASWAQYRAQEALVRVCDGAGIALTLFHGRGGSIGRGGAPAHDALLSQPPG
SLKGGLRVTEQGEMIRFKLGLPEIAVSSLTLYTSAILEANLLPPPAPKQEWRDVMDELSQ
TSCALYRRYVRENPDFVPYFRSATPELELGKLPLGSRPAKRRPSGGVESLRAIPWIFAWT
QNRLMLPAWLGAGAALEEAMAEGRRDTLESMYRSWPFFTTRIDMLEMVFAKSDLWLAEYY
DQRLVDPALWPLGTELRQQVQRDIQAVLAIANTDHLMADLPWAAESIALRNVYTDPLNVL
QAELLYRSRHQEQPDANVEQALMVTIAGVAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcaatattcggcgatgcgtggcaatgtcagcatgttgggcaagctgctgggc
gataccatcaaggacgcgctgggagaagatatcctggatcgcgttgaaactatccgcagg
ctgtccaagtcgtcacgcgcaggcaatgaagccagccgacaggcgctgctgaacacactg
caaaatctttccaatgacgagctgctgccggtggcgcgcgccttcagccagttcctcaat
ctggccaacgtcgcggagcaatatcaccgaatctccccgcacggcgaggccgccagcaat
cccgatgccctatctcacctgttcacccggctgaagaataaaaatctggacgaggcgcaa
atccgtcaggccgtcgacaacctctccatcgagctggtactgaccgcgcaccccaccgag
atcgctcgccgtacgctgatccataaactggtggaggtaaacacctgcctcagtcagctc
gatcatgacgatctggccgactatgagcgtcaccagatcatgcgccgtctgcgccagctg
gttgcccaatcctggcacaccgacgagatccgtaaaaatcgccctacgcccatcgacgaa
gccaaatggggctatgccgtggtcgaaaacagcctgtgggaaggcgttcccgccttcctg
cgtgagtttaatgaacagctggaaaaatcccttggctaccagctgccggtcgaagcggtg
ccggtgtgcttcaccgcctggatgggcggcgatcgcgacggtaacccaaacgtcaccgcc
gaggtgacccgccgcgcgctgctgctcagccgctggaaggccgcggagctgttcctgcgc
gatgtccaggtgctggtatcagagctctccatgaccgtctgtacaccggagctacgggcg
ctggcgggcgaacatgcccaggagccctaccgcgaggtgttaaaacgcctgcgccagcag
ttgaacaatacgctgacctatctggacgcgcgtctgcggggggagcgcctgccgcgcccc
accgatctgctggtcagcaatgatcagctgtggcagccgctgcatacctgctaccgctcg
ctgaaggcctgcggtatggggatcatcgccaacggtcagctgctagacaccctgcgccgg
gttcactgcttcggcgtgccgctggtacgcatcgacattcgccaggaaagcacccgccat
accgaggcgctggccgagctgacccgctatctggggctgggtgactatgagacctggtct
gaagaggataagcagacgttcctgctgcgcgagctgaactccaagcgtccgctggtgccg
cgtcactggacaccgtcgccggaaaccaaagaggtgtttgacacctgtcaggtgatcgcc
gaggcgcctgccggcgctatcgccgcctatgtcatctcgatggcgcgaaccccatccgat
gttctggcggtccacctgctactgaaagaggcgggctgcccgtacaatctgccggttgct
ccgctgttcgaaaccctcgacgatctgaacaatgccgaggcggtgatgacgcagctgctg
agcatcgactggtaccgtggctttatccagggtaaacagatggtgatgatcggctactct
gactccgccaaagacgccggcgtaatggcggcctcttgggctcaataccgggcgcaggag
gcgctggtacgcgtctgtgacggcgccgggatcgccctgaccctgttccacggtcgcggc
ggctccatcggccgcggcggcgcgccggcgcacgatgctctgctctcccagccgccggga
agcctgaagggcggcctgcgcgtaacggagcagggggagatgatccgcttcaagctcggc
ctgccggagatcgccgtcagcagcctgacgctctacaccagcgccattctggaagccaat
ctgctgccgccgccggcgccgaagcaagagtggcgcgatgtcatggacgagctctcacag
acatcctgcgcgctttatcgacgctatgtccgcgaaaatccagattttgttccttacttc
cgctcggcgacgcccgaattggagctgggtaaactgccgctaggctcgcgtccggccaaa
cgccgccccagcggcggcgtagagagcctgcgcgcgatcccttggatctttgcctggacc
caaaatcgcctgatgctaccggcctggctgggcgccggggccgcgctggaggaggccatg
gcagagggacgccgcgacacgctggaaagcatgtaccgcagctggccattcttcaccacc
cgtatcgatatgctggaaatggtgttcgccaagtccgatctgtggctggccgaatactac
gatcagcgcctggtcgatcccgccctatggccgctgggtacggagctacgccagcaggta
cagcgagatattcaggcggtgctggccatcgccaacaccgatcatctgatggccgatctg
ccctgggccgcagagtctatcgccctgcgtaacgtctataccgatccgctcaacgtcctg
caggctgagctgctctaccgctcgcgccaccaggaacagccggatgccaacgtcgaacag
gcgctgatggtcaccatcgccggggtcgctgccggaatgcgcaataccggctag

DBGET integrated database retrieval system