Escherichia coli UMNK88 (ETEC, porcine): UMNK88_1364 Help Entry UMNK88_1364       CDS       T02001                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism eun  Escherichia coli UMNK88 (ETEC, porcine) Pathway eun01100   Metabolic pathways eun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UMNK88_1364 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UMNK88_1364 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEE55976 LinkDB All DBs Position 1332371..1332607 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system