KEGG   Echinicola vietnamensis: Echvi_4341Help
Entry
Echvi_4341        CDS       T02388                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
evi  Echinicola vietnamensis
Pathway
evi00511  Other glycan degradation
evi00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:evi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Echvi_4341
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Echvi_4341
Enzymes [BR:evi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Echvi_4341
Bacterial toxins [BR:evi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Echvi_4341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR BNR_assoc_N Sortilin-Vps10 DUF4185
Motif
Other DBs
NCBI-ProteinID: AGA80527
UniProt: L0G4S7
LinkDB All DBs
Position
complement(5190402..5191928)
Genome map
AA seq 508 aa AA seqDB search
MGSLLIMMVNCTSRPTGAADVVQVTVNQHTVPVIKGQNNDVLSMEFTLKEGDVLEQISLA
TDGAEELEALTVYELEKGTGGNKEPIAALVRVGEKAVVNMDRPLSPGDHKLVVGIQPKKS
ASLKKTLQIGIKDISFGNSGAAIAKQSGSMPLRLATSLRNAGDDGVAAYRIPGLATTKKG
SLIAVYDIRHNSSVDLQEDIDVGMSRSTDGGENWEPMKTIMDMEEWGGKPQKENGIGDPA
ILVDPANNTIYVVALWLHGKPGERAWFSSGAGMSPDETGQLMMVKSHDDGKTWSDPINIT
RQIKKREWKLMFNGPGKGITMRDGTLVFAGQYKDENDMPYSTLIYSQDQGETWHIGTGAK
ANTTEAQVVELNDGSLMLNMRDNRGGARSVAVTKDLGKTWKEHPSSRSALVEPVCMASLI
TYPENRQSMDASHLFFSNPAVTDGRYNMTIKSSKDEGMSWTKGLLLDEGKGWGYSCLTVI
DKEHLGILYESSQAHMTFQIIRTTELIP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcctattgatcatgatggtcaactgtacttcccggcctacaggagcagcagac
gtggttcaggtaaccgtaaaccaacacaccgtcccggttatcaaggggcaaaacaatgat
gtactttcaatggaatttaccctaaaggaaggggatgttttggaacaaatatcattggcc
acggatggggctgaagaactggaggcactgactgtctatgaattggaaaagggaacagga
gggaataaagaacccatagcggcattggtaagggtcggtgaaaaagcggtggttaacatg
gacaggcccttatctcccggtgaccataaattggtggtgggcatccagcccaagaaaagc
gcgtccttaaagaaaacacttcaaataggcataaaggacatatcgtttggcaattccggt
gcagccattgcaaagcaaagcggttccatgccacttcgtctggccacaagcttacgaaac
gccggcgacgacggagtggccgcatataggatacccgggttggccacgaccaaaaaaggc
agtttgatcgcagtgtatgatatacggcacaacagctcggtagacctacaggaggatatt
gatgtgggaatgagcaggagtactgatggaggagagaactgggaacccatgaagaccatc
atggacatggaagagtggggagggaaaccccagaaggaaaatggcataggagatccggcc
atattagtggatccggccaataatacgatctatgtggtagccctttggctgcacggaaaa
ccgggagaaagggcttggttcagctcaggggcagggatgtctcccgatgaaacagggcag
ctgatgatggtcaaaagccacgatgatggaaagacgtggtctgatcccatcaatattacc
cgacaaatcaaaaaaagggagtggaaactcatgtttaacggtccgggcaaaggcattacc
atgagggacggtacattggtttttgccggacaatataaagatgaaaacgacatgccttac
agtaccctgatctacagtcaagatcaaggagaaacctggcatatcggaaccggggcaaag
gcaaataccaccgaggcccaggtagttgagctcaatgacggaagcctgatgcttaacatg
agggacaataggggcggggcacgttcagtggccgttaccaaagacctggggaaaacctgg
aaagagcatccttcaagccgatcagctttggtcgagcccgtctgtatggcaagtctcatt
acctaccctgaaaacaggcaatccatggatgcctctcatctgttcttttcaaatccggcc
gtaacagacgggaggtataacatgaccatcaaatccagtaaggacgaaggcatgtcatgg
actaaagggcttttattggatgaaggaaaaggttggggctactcttgcctcacggtaatc
gataaggagcatttgggcatcctgtacgagagcagccaagcccacatgacctttcagatc
ataaggaccactgaactgatcccatga

DBGET integrated database retrieval system