KEGG   Eggerthella sp. YY7918: EGYY_01770Help
Entry
EGYY_01770        CDS       T01566                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
eyy  Eggerthella sp. YY7918
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:eyy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    EGYY_01770
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EGYY_01770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EGYY_01770
   00430 Taurine and hypotaurine metabolism
    EGYY_01770
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    EGYY_01770
Enzymes [BR:eyy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EGYY_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
179185..180672
Genome map
AA seq 495 aa AA seqDB search
MEQSATSKVLDSMDEGTKYLTPIFGSESSDAQMPRLTMNDQPVEPRIAYEMIKEYLSIEG
NATQNLTTFCQTYMEPMATKIMAETLEKNAIDKDEYPMTADLENRCVAMIGDLWHANPDE
EPMGTSTVGSSEACMLGGLAMLFRWKKLAKDAGIDIYTAQRPNLVISAGYQVCWEKFCRY
WDIEMRLVPLEKDHLSLNMDTVMDYVDDHTIGITAILGITYTGKFDDVKKLDELVEAYNQ
EHTDLPIRIHVDGASGAMVAPFVNPDLEWDFRLKNVWSINTSGHKYGLVYPGIGWVVWRS
KEALPEDLIFWVSYLGGEQATMAINFSRSASQIVGQYYVLMRNGFEGFKEIQERTLDVAR
YLALELDEMGIFEIYEDASNIPIVCWGLKEDAGVEWSLYDLSDRLRMSGWLVPAYPMPAD
MQDTTVQRVVARADFSMQLAIKLVEDMKKEIDTLNKAKFVTGNTQGVIQTGFNHGGRAAV
NHGDKEQTKAPTPQK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagcaatcagcaaccagcaaagttcttgacagcatggatgaaggtacaaagtacctc
accccgatttttggttcagaatcatccgacgcgcagatgccgcgtcttacgatgaacgat
cagccggtcgagccgcgtatcgcctacgagatgatcaaggagtatctgtctattgaaggc
aacgccacgcagaacctgaccacgttctgccagacctacatggagcccatggccacaaag
atcatggccgaaacccttgagaagaacgccatcgacaaggacgaataccccatgacggcc
gatctggagaatcgttgcgtcgccatgatcggcgacttgtggcacgcaaatcccgacgaa
gagcctatgggcacgtccacggtcggttcgtccgaggcctgcatgctgggcggtttggcc
atgctcttccgctggaagaagctcgcgaaggacgccggtattgacatctacaccgcgcag
cgcccgaatctggtcatttctgccggttaccaggtatgctgggaaaaattctgccgttac
tgggacatcgagatgcgcctcgtgccgcttgagaaggaccacctgtcgctgaacatggat
acggtcatggactatgtggacgaccacaccattggcatcacggctattctcggcatcact
tataccggtaagtttgacgacgtgaagaagctcgacgagttggtggaggcctacaaccaa
gagcacacagacctgcccatccgcattcatgtggacggtgcttcgggcgccatggtggcc
ccgttcgtgaaccctgacttggagtgggacttccgtctgaagaatgtctggtccatcaac
acgtccggccacaagtacggcctggtgtaccccggcatcggctgggtcgtgtggcgcagc
aaggaagcgctgcccgaggacctgatcttctgggtgagctatctgggcggcgagcaggct
acgatggccatcaacttctcgcgctcggcttcacagatcgtaggtcagtactacgtgctt
atgcgcaacggcttcgaaggcttcaaggaaattcaggagcgcacgctcgacgtggcccgc
tatctggcgctcgaactggacgagatgggtatctttgagatctatgaggatgcgtccaat
atcccgatcgtatgctggggcctcaaagaggatgccggtgtggagtggtcgctctacgac
ctgtccgatcgcttgcgcatgagtggctggctggttccggcgtatccgatgcccgccgac
atgcaggacaccaccgtccagcgtgtcgtggcccgcgccgacttctccatgcagctggct
atcaagctggttgaagatatgaagaaggagatcgacaccctgaacaaggcaaagtttgtc
accggcaatacccagggcgtcatccagaccggcttcaaccacggcggtcgtgccgctgtt
aaccacggcgacaaagagcagacgaaggcccccacgccccagaagtaa

DBGET integrated database retrieval system