KEGG   Ficedula albicollis (collared flycatcher): 101811826Help
Entry
101811826         CDS       T02815                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101811826 (F13A1)
Cell adhesion molecules and their ligands [BR:fab04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101811826 (F13A1)
   VLA-9
     101811826 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 735 aa AA seqDB search
MSETTSTNEENKLPLNGRRAIPPNYSNDEENEVPEMEAFGLIPRGFNPRDYLRVVDIYMF
KEPQEINKQEHHTDKYYNPKLIVRRGQAFQIQIDFNRPYKPETDQFWLEFLMGRYPQQNK
GTYIPVVVGNVLKPGQWGAKIIHRENNSIRLSIMSSATCIIGKFRLYVAVLTPYGILRTR
RNSATDTYILFNPWCQLDAVYMDDEKERQEYVLNDVGIVFHGNVEDVKSRSWSYGQFEEN
ILDACLFLMDKAELELSGRGNPIKICRVASAVINSRDEDGVIAGSWNNSYDYGVAPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRLDFF
LDDEGKVDTRLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDAPFVYAEVNSDIFYTRVEKNGAQVVEKIDTTRIGQLIVTKEVGGDG
MVDITEEYKFREGSDEERLALETAVMYGVKKQSVQDTTYQPQTDVDMDFQAQKAVLGNDF
KVTITFRNKSRNSYTATTYLSGNIVFYTGVTKSEFKKHSFSAKLEPSSSSSFNIVIKSSE
YMSELLEQASFHFFVTARINETGKILAVQKAVMLEIPTLRIKTKGELVAGKEASVIVEFT
NPLKQTLENVTLRLEGPGVLRTIKKEFGRTPMNSTLTWEVKFFPMRPGLRKLIASLNSNA
LRHVYGELNVQIQKP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaacgagcaccaatgaggagaataaacttcctttgaatgggagaagagcc
atcccaccaaactactcaaatgatgaagaaaatgaagttcctgagatggaagcttttgga
ttgatacctagaggatttaatcctagagattacctgcgtgttgtggatatttatatgttc
aaggagcctcaagagatcaacaagcaggagcaccacactgacaagtactacaaccccaag
ctgatagtacgtcggggacaggctttccaaatccagattgacttcaaccgaccctacaag
ccagaaacagaccagttctggctggagtttttgatgggtcgctacccacagcaaaataaa
ggcacctacatcccagtcgtagtgggcaatgtgctaaaacctggtcagtggggagcaaag
attatccacagggaaaacaactccattcggctgtccatcatgtcctctgccacctgcatc
atcgggaagtttcgcttgtacgttgctgtcttgactccctacggcatccttcggacacgc
aggaattcagcgaccgacacttacatcttgttcaatccctggtgccagttggatgctgtg
tatatggatgatgagaaagaaaggcaagaatatgtcctgaatgatgttggtattgtattc
catggaaacgtcgaggatgtgaaatcaagaagctggagttacgggcagtttgaggaaaac
attctggatgcttgtctgttcctgatggacaaggcagaactggagctctctggtcgtggg
aacccaatcaaaatctgccgtgttgcctcagcagtgattaactccagggatgaggatggt
gtgattgctggatcctggaacaattcgtatgactatggtgttgcaccttcagcctggacg
gggagtgtggacattctcttggagtattacagttccaagcaacctgtccgatatggccag
tgctgggtcttcgctggtgtcttcaacacgtttctgagatgcttggggatacctgcaaga
ctcattaccaactattcctctgcccatgataacaatgccaatttacggttggacttcttt
ctggatgacgaagggaaagtggacaccagacttacaaaagactctgtctggaattatcat
tgctggaacgaagcttggatgaccagacctgaccttcctgtaggttttggaggatggcag
gttgtcgatgggacacctcaagaaaccagtgatggtatgtacaggtgtggtccagcctca
gttcaagccattaaacatggtcatgtttgcttccaatttgatgctccttttgtctatgct
gaggtgaatagtgacattttttacacaagagtggagaaaaatggagcccaagtggtagaa
aagatcgacacaacccgtattgggcagttgattgtgaccaaggaagttggaggtgatgga
atggtggacattactgaggagtacaagttccgagaaggctcagacgaggagagactggct
cttgagactgctgtgatgtatggtgttaaaaagcaaagtgtccaagacaccacgtaccag
ccacagacagatgttgatatggacttccaagcacaaaaggcagtccttggcaatgacttt
aaagtcactataactttcaggaacaagagtcgtaactcctacactgcaactacctacctt
tcaggcaacatagtgttttatacaggagtcacaaaaagtgaattcaagaaacactctttc
agtgcaaaactggaaccctcttcatccagctctttcaatattgtgatcaaatcgagcgag
tacatgagcgagctgctggagcaagcctccttccacttctttgtgactgcgaggatcaac
gaaacggggaagatcctggccgtgcagaaggcagtaatgctggaaattcccaccctgcgc
atcaagaccaaaggtgaactggtagctggtaaagaagcgtctgtgattgtggaattcacc
aatcctctgaaacaaaccctggagaacgtcacgctccgcctcgagggacctggcgtgctg
agaacaataaagaaagagttcgggagaaccccaatgaactctacattgacctgggaagta
aagtttttcccaatgagaccaggtttacggaagctgattgcaagcctgaattctaatgct
ctgagacatgtgtatggtgagctgaatgtccagattcagaaaccatga

DBGET integrated database retrieval system