KEGG   Ficedula albicollis (collared flycatcher): 101816758Help
Entry
101816758         CDS       T02815                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101816758 (HDAC4)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101816758 (HDAC4)
Chromosome [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101816758 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 1115 aa AA seqDB search
MPSSVDVSTALPLQVAPSSVPMDLRLDHQFSMPVTEPTLREQQLQQELLALKQKQQIQRQ
ILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQH
REQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRFWYGKTQ
HSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSP
LLRRKDGPVVTALKKRPLDVTGTADSACNSAPGSGPSSPNNSSNNISTENGIAGSVTSIQ
AETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPATGPSSAGQAQQDAERLAIPTLQQR
ISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLLEQPTAQTPLVTDWYLSGLPLHAQP
LVGGERVSPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQL
HINKIISKPAEPARQHESHPEETEEELREHQALLEEPYGERGQKEPPGLASVVQVKQEPI
ESDEEEAEPQQELEAGQRQAEQELLFRQQALLLEQQRIHQLRNYQASLEAAGMPVSFGGH
RPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQS
IWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTS
MFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHA
EESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISLHR
YDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGDTEYLTAFRTVVMPIANEFAP
DVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDA
SEACVSALLGNELDPLPEKVFQQRANANAVHSMEKVIEIHSKYWHSLQRFASTVGYSLVE
AQKCENEEAETVTAMASLSVGVKPAEKRSVVSLHISRSAQAGGAALQVNPLLSVTATASP
TSPVLCGGFPKPSWAAGEQQSHKLCACTLCLSLLL
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctctgttgacgtgagcacagccctgcccttgcaagtggcgccgagctcggtg
cccatggacctgcggctggaccaccagttctccatgccggtgacggagcccacgctgcgc
gagcagcagctgcagcaggagctgctggccctcaagcagaagcagcagatccagaggcag
atcctgatcgcggagttccagcggcagcacgagcagctctcccggcagcacgaggcgcag
ctgcacgagcacatcaagcagcagcaggagatgctggccatgaagcatcagcaggagctg
ttggagcaccagaggaagctggagcagcaccgacaggagcaggagctggagaagcagcac
cgagagcagaaactgcagcagctgaaaaacaaagagaaaggaaaagagagtgcagtggca
agcacagaagtgaagatgaaattacaggaatttgtgttgaacaagaagaaggctctggcc
caccggaatctcaaccactgcatatccagcgaccctcgcttctggtacgggaagacccag
cacagctctctggaccagagctccccaccccaaagtggcgtctccggcacctacaaccac
ccagtcctggggatgtacgattccaaagacgacttcccgctcagaaaaacagcctctgaa
cccaacctgaagctgcgctccagactaaagcagaaggtggctgagaggaggagcagcccg
ctcctgcgcaggaaggacgggcccgtggtgacggcgctcaagaagcgcccgctggacgtc
acaggcacggcggactctgcatgcaacagtgctcctggatctggtcccagctctccgaac
aacagttccaacaacatcagcaccgagaacggaattgcaggatcagtcacgagtatccag
gcagagaccagcctggctcacaggctcgtcaaccgcgagggctctgtgacccagctgccg
ctctacacctcgccctccctgcccaacatcacgctaggactgcctgccaccggcccttcc
agcgcgggacaagcgcagcaggacgcggagaggctggcaatcccaaccttacagcagaga
atctccttattccctggcactcacctcactccctacctgagcactacaacgttggagagg
gatgggggaactgcacacaaccctctcctgcagcacatggtcctactggaacagccaact
gcacaaacgcccctggtcacagactggtatctttcaggactgcccctgcacgcacagccc
ctggtgggtggagagagggtctccccttcgatccacaagctgcggcagcaccgcccgctc
gggcgcacccagtctgctcccctgccccagaacgcccaggccctccagcagctggtgatc
cagcagcagcaccagcagttcctggagaaacacaaacagcaattccagcagcagcagctg
cacatcaacaagatcatctccaagcccgcggagccggcgcggcagcacgagagccacccc
gaggagacggaggaggagctgcgggagcaccaggcgctgctggaggagccctacggcgag
cggggccagaaggagcccccggggctggccagcgtggtgcaggtcaagcaggagcccatc
gagagcgacgaggaggaggcagagccgcagcaggagctggaggccgggcagaggcaggcg
gagcaggagctgctcttccgccagcaagccctgctgctggagcagcagcggattcaccag
ctgaggaactaccaggcgtcgctggaggcagctggcatgcccgtgtccttcgggggacac
cggcccctgtcccgggcacagtcctcccccgcctcggccaccttccccatgtccgtgcag
gagccacccactaagccaaggttcacaacaggccttgtgtacgacacattgatgctgaag
caccagtgcacctgtggaaacaccaacagccaccccgagcatgcgggcaggatccagagc
atctggtccagactccaggagacagggctacggggcaagtgtgagtgcatccgtggcaga
aaggcgacgctggaggagctgcagacggttcactcggaagcccacaccctgctttatggc
actaaccctctgaacaggcagaaactggacagcaagaagcttctaggttccctaacgtcg
atgtttgtcaggctgccttgcggtggtgttggggttgacagtgacaccatttggaacgag
gtgcactcctccggcgccgctcgcctggctgtgggctgtgtcattgagctggtgttcaaa
gtggccacaggagaactgaagaatggatttgctgttgtccggcccccgggtcaccacgcg
gaggagagcacgcccatgggtttctgctattttaactccgtggcaattgcagccaagctg
ctccagcaaaggctcaacgtgagcaaaatcctcatcgtggactgggatgtccaccatggg
aatggtactcagcaggccttctacaacgatcccaacgtcctttatatctcactacatcgc
tacgatgatggcaacttcttcccaggcagcggcgctccagatgaggttggcacaggagca
ggagttggtttcaatgttaacatggcatttactggtggcctggatccgcccatgggagac
acagaatatttaactgccttcaggacagtagtgatgcccattgccaacgagtttgcccca
gatgttgtgctggtgtcatctggtttcgatgctgtggaagggcaccccacaccccttgga
ggatataatctgtcagcaaaatgcttcgggtacctgacgaagcagctgatggggctggcc
gggggccgcgtcgtgctggccctcgagggtggccacgacctcaccgccatctgcgacgcc
tcggaggcttgtgtgtctgccctgctgggaaacgagcttgaccctcttccagagaaggtt
ttccagcagagagcaaatgctaacgcggtgcattccatggagaaagtcatcgagatccac
agcaagtactggcattccctgcagcgtttcgcctccacggtgggatattccctggtggag
gcccagaagtgtgagaacgaggaggcggagacagtgacggccatggcatcgctgtcagtg
ggcgtgaagccggcggagaagaggtcagtggtttcccttcacatttccaggtctgcccag
gcaggaggagcagccttgcaggttaatcctctcctttcagtcactgctactgcatccccc
acatcccctgtcctctgtggtgggttcccaaaaccctcctgggctgcaggagagcagcag
agccataagctctgtgcgtgcaccctgtgcctgagccttctgctctga

DBGET integrated database retrieval system